KEGG   Viruses: 3077531
Entry
3077531           CDS       T40000                                 

Gene name
UL38, HHV5wtgp043
Definition
(RefSeq) Human betaherpesvirus 5; protein UL38
  KO
K22776  Cytomegalovirus apoptosis inhibitor UL38
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: US22
Other DBs
NCBI-GeneID: 3077531
NCBI-ProteinID: YP_081497
RS: NC_006273
UniProt: F5HG98 C8BKZ2 V9LLY9
LinkDB
Position
NC_006273:complement(51482..52477)
AA seq 331 aa
MTTTTHSTAAIMSLLDEAEWRQTQMDVGGLIQASALGKVALRYAVRKLMKRGARLRHDSG
LYVCICDPSYEFLQMNLSKISWLERHCPPLDQELIMFGVIEAWEEASVRPTRQLVLFMTP
KWDVFAYDSGILFFLAPSMAQFWHGAIVLEYWNALFPVEVRSHVRQHAHTMDDLVMVFHQ
LDYEKQVLEARRDKNTEGPRTFAKSVNSYVRAILESERRIREGKIPMTFVDRDSLRANSL
AHIQATGAQPSHAPAQRVLSAPPSLPSPVSEEDPAAAATPPSSAATTPPSSVVPASVESE
LSSSPPLPPVVVKDVMYTAGEGDVVQMVVVV
NT seq 996 nt   +upstreamnt  +downstreamnt
atgactacgaccacgcatagcaccgccgctatcatgagcctgctggacgaggccgagtgg
cgacagacgcagatggacgtggggggactgatccaggcgtcggcgttgggcaaggtggcg
cttcgctacgcggtgaggaaactgatgaagcgcggagccaggctgcggcacgactcgggt
ctctacgtgtgcatctgcgacccctcttacgagtttctgcagatgaacctgagcaagatc
agttggctggagcgacactgccccccgttggaccaggagctcatcatgttcggggtcatc
gaggcctgggaggaagcttcggtgcggcccacgcgtcagctggtgttgttcatgacgccc
aagtgggacgtgttcgcctacgactccggtatcctgtttttcctggcgcccagcatggcg
cagttctggcacggtgccatagtgctggagtattggaacgctttgttcccggtggaggtg
cgctcccacgtccgtcagcacgcgcacactatggacgacctggtgatggtcttccaccag
ctggactacgaaaagcaggtgctggaagcgcgtcgcgacaagaatacggaggggccgcgc
acttttgccaagtcggtgaacagctacgtgcgcgccatcctggaatctgagcggcgaatc
cgcgaagggaaaattcctatgaccttcgtggatcgcgactcgctgcgagccaattcgttg
gcccacatccaggccaccggggctcagccttctcacgctccggcgcaacgggtgctgtcc
gcgccgccgagcctgccgtcgcccgtgtcggaagaagaccccgctgccgccgccacccct
ccgtcctccgccgccaccacccccccgtcctctgtcgtcccggcctccgtcgagagcgag
ttgtcctcgtcgccgccgttgccgccggtcgtggtgaaggatgtgatgtacacggccggg
gagggcgacgtggtacagatggtggtcgtggtctag

DBGET integrated database retrieval system