KEGG   Viruses: 3077536
Entry
3077536           CDS       T40000                                 

Gene name
US28, HHV5wtgp158
Definition
(RefSeq) Human betaherpesvirus 5; envelope protein US28
  KO
K22781  HCMV envelope protein US28
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx HCMVantigenic_N
Other DBs
NCBI-GeneID: 3077536
NCBI-ProteinID: YP_081612
RS: NC_006273
UniProt: F5HF62 Q80KM9
LinkDB
Position
NC_006273:225435..226499
AA seq 354 aa
MTPTTTTAELTTEFDYDEDATPCVFTDVLNQSKPVTLFLYGVVFLFGSIGNFLVIFTITW
RRRIQCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLASVPCTLLTACFYVAMFASLC
FITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAIPHFMVVTKKDNQCMTDYDYL
EVSYPIILNVELMLGAFVIPLSVISYCYYRISRIVAVSQSRHKGRIVRVLIAVVLVFIIF
WLPYHLTLFVDTLKLLKWISSSCEFERSLKRALILTESLAFCHCCLNPLLYVFVGTKFRQ
ELHCLLAEFRQRLFSRDVSWYHSMSFSRRGSPSRRETSSDTLSDEVCRVSQIIP
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgacaccgacgacgacgaccgcggaactcacgacggagtttgactacgatgaagacgcg
actccttgtgttttcaccgacgtgcttaatcagtcaaagccagttacgttgtttctgtac
ggcgttgtctttctcttcggttccatcggcaacttcttggtgatcttcaccatcacctgg
cgacgtcggattcaatgctccggcgatgtttactttatcaacctcgcggccgccgatttg
cttttcgtttgtacactacctctgtggatgcaatacctcctagatcacaactccctagcc
agcgtgccgtgtacgttactcactgcctgtttctacgtggctatgtttgccagtttgtgt
tttatcacggagattgcactcgatcgctactacgctattgtttacatgagatatcggcct
gtaaaacaggcctgccttttcagtattttttggtggatctttgccgtgatcatcgccatt
ccacactttatggtggtgaccaaaaaagacaatcaatgtatgaccgactacgactactta
gaggtcagttacccgatcatcctcaacgtagaactcatgctcggtgctttcgtgatcccg
ctcagcgtcatcagctattgctactaccgcatttccagaatcgttgcggtgtctcaatcg
cgccacaaaggtcgcattgtacgggtacttatagcggtcgtgcttgtctttatcatcttt
tggctgccgtaccacctgacgctgtttgtggacacgttaaaactcctcaaatggatctcc
agcagctgcgagttcgaaagatcgctcaaacgtgcgcttatcttgaccgagtcgctcgcc
ttttgtcactgttgtctcaatccgctgctgtacgtcttcgtgggcaccaagtttcggcaa
gaactgcactgtctgcttgccgagtttcgccagcgactcttttcccgcgatgtatcctgg
taccacagcatgagcttttcgcgtcggggctcgccgagtcgaagagagacatcttccgac
acgctgtccgacgaggtgtgtcgcgtctcacaaattataccgtaa

DBGET integrated database retrieval system