KEGG   Viruses: 3077563
Entry
3077563           CDS       T40000                                 

Gene name
UL122, HHV5wtgp107
Definition
(RefSeq) Human betaherpesvirus 5; regulatory protein IE2
  KO
K22775  Cytomegalovirus viral transcription factor IE2
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: Herpes_IE2_3 Herpes_IE1 MazG RGCC
Other DBs
NCBI-GeneID: 3077563
NCBI-ProteinID: YP_081561
RS: NC_006273
UniProt: Q6SW29 F5HE22
LinkDB
Position
NC_006273:complement(join(170689..172175,173719..173903,174020..174090))
AA seq 580 aa
MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEVNSQLSLGDPLFPELAE
ESLKTFEQVTEDCNENPEKDVLTELGDILAQAVNHAGIDSSSTGPTLTTHSCSVSSAPLN
KPTPTSVAVTNTPLPGASATPELSPRKKPRKTTRPFKVIIKPPVPPAPIMLPLIKQEDIK
PEPDFTIQYRNKIIDTAGCIVISDSEEEQGEEVETRGATASSPSTGSGTPRVTSPTHPLS
QMNHPPLPDPLGRPDEDSSSSSSSSCSSASDSESESEEMKCSSGGGASVTSSHHGRGGFG
GAASSSLLSCGHQSSGGASTGPRKKKSKRISELDNEKVRNIMKDKNTPFCTPNVQTRRGR
VKIDEVSRMFRHTNRSLEYKNLPFMIPSMHQVLEEAIKVCKTMQVNNKGIQIIYTRNHEV
KNEVDQVRCRLGSMCNLALSTPFLMEHTMPVTHPPDVAQRTADACNDGVKAVWNLKELHT
HQLCPRSSDYRNMIIHAATPVDLLGALNLCLPLMQKFPKQVMVRIFSTNQGGFMLPIYET
AAKAYAVGQFEKPTETPPEDLDTLSLAIEAAIQDLRNKSQ
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggagtcctctgccaagagaaagatggaccctgataatcctgacgagggcccttcctcc
aaggtgccacggcccgagacacccgtgaccaaggccacgacgttcctgcagactatgtta
aggaaggaggttaacagtcagctgagcctgggagacccgctgttcccagaattggccgaa
gaatccctcaaaacctttgaacaagtgaccgaggattgcaacgagaaccccgaaaaagat
gtcctgacagaactcggtgacatcctcgcccaggctgtcaatcatgccggtatcgattcc
agtagcaccggccccacgctgacaacccactcttgcagcgttagcagcgcccctcttaac
aagccgacccccaccagcgtcgcggttactaacactcctctccccggggcatccgctact
cccgagctcagcccgcgtaagaaaccgcgcaaaaccacgcgtcctttcaaggtgattatt
aaaccgcccgtgcctcccgcgcctatcatgctgcccctcatcaaacaggaagacatcaag
cccgagcccgactttaccatccagtaccgcaacaagattatcgataccgccggctgtatc
gtgatctctgatagcgaggaagaacagggtgaagaagtcgagacccgcggtgctaccgcg
tcttccccttccaccggcagcggcacgccgcgagtgacctctcccacgcacccgctctcc
cagatgaaccaccctcctcttcccgatcctttgggccggcccgatgaagatagttcctct
tcgtcttcctcctcctgcagttcggcttcggactcggagagtgagtccgaggagatgaaa
tgcagcagtggcggaggagcatccgtgacctcgagccaccatgggcgcggcggttttggt
ggcgcggcctcctcctctctgctgagctgcggccatcagagcagcggcggggcgagcacc
ggacctcgcaagaagaagagcaaacgcatctccgagttggacaacgagaaggtgcgcaat
atcatgaaagataagaacacccccttctgcacacccaacgtgcagactcggcggggtcgc
gtcaagattgacgaggtgagccgcatgttccgtcacaccaatcgttctcttgagtacaag
aatctgccattcatgatccctagtatgcaccaagtgttagaagaggccatcaaagtttgc
aaaaccatgcaggtgaacaacaagggcattcagatcatctacacccgcaatcatgaagtg
aagaatgaggtggatcaggtacggtgtcgcctgggtagcatgtgcaacctggccctctcc
actcccttcctcatggagcacactatgcctgtgacacaccctcctgatgtggcgcagcgc
acggccgatgcttgtaacgacggtgtcaaggccgtgtggaacctcaaagaactgcacacc
caccaattgtgcccccgctcttctgattaccgcaacatgattatccacgctgccaccccc
gtggacctgttgggcgctctcaacctgtgcctgcccctgatgcaaaagtttcccaaacag
gtcatggtgcgcatcttctccaccaaccagggtgggttcatgctgcctatctacgagacg
gccgcgaaggcctacgccgtggggcagtttgagaagcccaccgagacccctcccgaagac
ctggacaccctgagcctggccatcgaggcagccatccaggacctgaggaacaaatctcag
taa

DBGET integrated database retrieval system