KEGG   Viruses: 3077571
Entry
3077571           CDS       T40000                                 

Gene name
UL22A, HHV5wtgp027
Definition
(RefSeq) Human betaherpesvirus 5; glycoprotein UL22A
  KO
K22784  HCMV glycoprotein UL22A
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: Cytomega_UL20A GRP Chordopox_A33R
Other DBs
NCBI-GeneID: 3077571
NCBI-ProteinID: YP_081481
RS: NC_006273
UniProt: P16845 F5HF90 D2K3J1
LinkDB
Position
NC_006273:join(27443..27528,27612..27843)
AA seq 105 aa
MARRLWILSLLAVTLTVALAAPSQKSKRSVTVEQPSTSTNSDGNTTPSKNVTLSQGGSTT
DGDEDYSGGDYDVLITDTDGGNHQQPQEKTDEHKGEHTKENEKTQ
NT seq 318 nt   +upstreamnt  +downstreamnt
atggctcggaggctatggatcttgagcttactagccgtgaccttgacggtggctttggcg
gcaccttctcagaaatcgaagcgcagcgtgacggtggaacaacccagtaccagcactaac
tccgatggtaataccacccccagcaagaacgtaactctcagtcagggggggtccaccacc
gacggagatgaagattactccgggggagactatgacgttttgattacggatacagatgga
ggtaaccatcagcaaccacaagagaagaccgacgaacacaagggagaacacaccaaagaa
aatgaaaagacccagtag

DBGET integrated database retrieval system