KEGG   Viruses: 30855050
Entry
30855050          CDS       T40000                                 

Gene name
BWV06_gp038
Definition
(RefSeq) Cynomolgus cytomegalovirus; Cy56
  KO
K22782  Cytomegalovirus G-protein coupled receptor UL33
Taxonomy
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus; unclassified Cytomegalovirus
Organism
vg  Viruses (Cynomolgus cytomegalovirus)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv DUF2207
Other DBs
NCBI-GeneID: 30855050
NCBI-ProteinID: YP_009337483
RS: NC_033176
UniProt: A0A1L6Z003
LinkDB
Position
NC_033176:join(42733..42759,42836..44014)
AA seq 401 aa
METILHNRTTNNEGILNINTTCNVTDSLHAAKLGEALVNSALSLFGTPLNAIVLVTQLLA
NRVHGYSTPIIYMTNLYSANFLTLIVLPFIVLNNQHLLTASAITCKFLSLLYYSSCSVGF
ATVALIAADRYRVIHRRTQARQSYRNTYLIVGLTWLIGFICATPGGVYTTIVSHRDGEND
VQAHTTCIMHFAYDDVYVLMVWKLLIVLVWGVVPVIMMSWFYAFFYNTVQRTAKKQQRTL
KFVKVLLLSFIIIQTPYVSMMIFNTYATVGWSLECEDLTKRRVINTFSRLVPNLHCVVNP
ILYALMGNDFVTKVGQCFRGELTNRRTFLRSKQQARNSDDVPTIVSQQPATPTIVNKAEK
DPHVKRGVSFSVSASSELAAAKKAKAKAKRLSMSHQNLRLT
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggaaaccattcttcacaaccgaacgacaaacaatgaaggtattttgaacatcaacacc
acctgcaatgtgaccgactcgctgcacgccgccaagctaggcgaggccctcgttaacagc
gcgctatctttattcggtacccccctcaacgccatcgtccttgtcacacagctattggcc
aaccgagttcatggatactccaccccgattatctacatgaccaatctctactctgccaat
tttctcaccttgatagtgctacctttcattgttttaaacaaccaacaccttttgactgcc
agtgcgataacctgtaaatttctctccctcttatactactctagttgcagtgtaggcttc
gctacagtggcactgatcgcagccgaccgataccgagtgattcatcgccgaactcaagct
cgccaatcttaccgcaacacatatctgatagtaggattaacatggctaattggttttatt
tgcgctaccccagggggagtatacacaaccattgtatcccaccgcgacggagaaaatgat
gtccaagcacatactacttgtatcatgcactttgcatacgatgatgtgtacgtcctcatg
gtgtggaaacttttaattgttttagtatggggcgtagtgccagttatcatgatgagctgg
ttctacgccttcttctacaacactgtacagagaacagccaaaaaacaacagcgcacgttg
aaattcgtaaaagtcctacttctgtcattcatcatcatccaaactccctatgtatcaatg
atgatctttaacacatatgccaccgtcggatggtcgctggagtgcgaggatctgactaag
cgccgagtcatcaacacattctctcgcctcgtccccaatctacattgcgtggtcaacccc
atcctctacgctctaatgggaaatgacttcgtgaccaaagtgggccaatgcttccggggg
gaactcacgaaccgtcgaacttttctacgttccaagcaacaagcccgtaactcagatgat
gtaccgacaattgtcagtcaacaacccgccacacctaccatcgtcaataaggccgaaaaa
gacccgcacgtaaaacgcggtgtatctttcagcgtcagcgcatcttccgaactcgcagcg
gccaaaaaagccaaagccaaagccaagcggctttccatgtcccaccaaaacctacgtctg
acgtga

DBGET integrated database retrieval system