KEGG   Viruses: 30855053
Entry
30855053          CDS       T40000                                 

Gene name
BWV06_gp041
Definition
(RefSeq) Cynomolgus cytomegalovirus; Cy61/Cy60
  KO
K22788  Cytomegalovirus viral inhibitor of caspase-8-induced apoptosis
Taxonomy
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus; unclassified Cytomegalovirus
Organism
vg  Viruses (Cynomolgus cytomegalovirus)
SSDB
Motif
Pfam: US22
Other DBs
NCBI-GeneID: 30855053
NCBI-ProteinID: YP_009337486
RS: NC_033176
UniProt: A0A1L6Z0W9
LinkDB
Position
NC_033176:complement(join(47035..48224,48305..48530))
AA seq 471 aa
MSYRLMSGMDDLRDTLMAYGCIAVRAQDPASLYTFVDQECGTKLHLAWPDNGYVQLRPRT
LMGPFSSKYYDVCCQGKYVCCNELMEPFGVVELSKLSFYQLVMLIGRSGAIYCYEETEKC
VYCLAPDMKSFIQLGLRRCDYLQKMELYQEPVIECDEIMKELMIFNWDVDRISDVVAKNG
YRVYDIRDPLGEQVDSHFALWSSDTAVANFQDTSFSLMSPSGLRSFEIMVRCVARIVCVN
QLLGVLGCFRKEKNEFLVRLYVLVDKFGTIYGFDPALNSIYRLAEDMRMFTCMMGRKGYR
NHRHDRKRAAIVRLEKVPYCMHGEEPSDPMIMFNDDSEDEKPPKTEADIVVGIYEAIKAD
IRFGVDMMMRDSSVTQKFWPQHLEALSDSPLLPSLIYDMEDVRSKMLGNIADMRAFDMSF
VGLAEDNDSDREETVRGYLFDDTVCTRCVSSRRLRLFRSGRGMGRARVSYV
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgagttaccggttgatgtcgggcatggacgatcttcgggatactttgatggcatatggc
tgcatcgcagtgcgcgctcaagatcctgctagcttatacacatttgtggatcaggaatgt
ggaaccaaattgcatcttgcttggcccgacaatggctatgtccagctacgtccccgcact
ctcatgggaccattcagctccaagtattacgatgtgtgctgccaaggaaagtacgtgtgc
tgcaacgaactcatggaaccgtttggagtggtggagctttcgaagctaagtttctaccag
ctcgtcatgctgatcggtcgaagcggtgctatctactgttatgaagaaaccgaaaagtgc
gtgtattgtctggcacctgacatgaagtccttcatccaactcgggctacgtcgttgtgac
tatctccaaaaaatggagctttatcaggaacctgtgattgagtgtgatgaaattatgaag
gagctcatgatcttcaactgggatgtggacagaatatcggacgtggttgcgaagaacggt
taccgcgtctacgatattagggatcccctgggtgaacaagtagatagtcattttgccttg
tggtccagtgacactgcagtggccaattttcaagacacttcttttagtctcatgtcacct
tcagggctgcgttcctttgaaatcatggtgcgttgcgtggcccgtatagtgtgtgttaat
cagttgctcggggtgctaggttgcttccgcaaagaaaaaaatgagttcctagttaggctc
tatgtactagttgacaagttcggtacaatttatggctttgatcccgccctaaactccatc
tatcgcctagctgaggatatgcgaatgtttacctgcatgatgggaagaaagggttaccgg
aatcacagacatgatagaaaacgcgcagctatcgttaggttggaaaaggtcccgtattgt
atgcatggcgaagaacccagtgatcccatgatcatgttcaatgatgacagtgaagacgaa
aaaccgcccaaaacggaggccgatatcgttgtgggcatttatgaagccataaaagccgat
atcagattcggtgtggacatgatgatgcgggactcgtctgtcactcaaaagttctggcct
cagcatcttgaagccctttccgattcacctttgctaccttctctgatctacgacatggaa
gatgtgagatcaaaaatgctcggcaatattgcggacatgcgagcttttgatatgtcgttt
gttggactcgcggaagacaacgattcagatcgcgaagaaacagtccgaggatatcttttt
gatgacaccgtgtgcacgcggtgtgtgtctagtcggcgcctccgattgtttcgctccgga
cgcggaatgggtcgtgctagagtttcttatgtgtaa

DBGET integrated database retrieval system