KEGG   Viruses: 30855055
Entry
30855055          CDS       T40000                                 

Gene name
BWV06_gp043
Definition
(RefSeq) Cynomolgus cytomegalovirus; Cy64
  KO
K22776  Cytomegalovirus apoptosis inhibitor UL38
Taxonomy
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus; unclassified Cytomegalovirus
Organism
vg  Viruses (Cynomolgus cytomegalovirus)
SSDB
Motif
Pfam: US22
Other DBs
NCBI-GeneID: 30855055
NCBI-ProteinID: YP_009337488
RS: NC_033176
UniProt: A0A1L6Z0T7
LinkDB
Position
NC_033176:complement(49750..50634)
AA seq 294 aa
MATSAEYDQEQKMQQNQMNIGSLIQASVLGKTALRAQVKKLMACDAHIKHEFGVTVCICD
HTYTFLGINLCKIGWLERNCPPLSHALTMFGVIEAWDEAAPRPSRQVVLFMSDNYDIYAY
DTGILFFMAPTMSEFWTAPIVFEYWNGIFPLEVRHRVRQYAKSVDDLIVIFNQVYHQRDV
LEARRQKNQNSPRTFARFLCGYVRALLDAERRVREGKIPVPFVDRDSLMANVIPVTPPTP
SVQEPERGVDSKKALTRQCSLPTPDPKKVNAHPDDDSDSDESIVDLTMEGAASL
NT seq 885 nt   +upstreamnt  +downstreamnt
atggctacttctgcagaatacgatcaggaacagaagatgcaacagaatcagatgaacata
ggtagtctcattcaggcttctgtgctgggcaagaccgcgctcagggctcaagtgaagaag
cttatggcgtgtgatgcacatattaagcatgaatttggcgttaccgtgtgcatatgtgat
catacgtacacgtttctggggattaacctttgtaaaatcggttggctggagcgcaattgt
ccgcccctgagtcatgccttaactatgtttggagttatcgaggcttgggacgaggctgct
cctcgaccctccagacaggtggtgctgtttatgagtgataactatgacatttacgcctat
gatactggaatcctgttcttcatggcaccgaccatgtccgagttttggacagctcccatc
gtttttgagtactggaatggcatctttcccttagaggtcaggcaccgggttaggcagtat
gccaaatctgtggacgatctcattgtgattttcaaccaggtgtaccaccagcgagacgta
ttggaagcccgcagacagaagaatcagaacagtcctcggacgtttgccagatttctctgc
ggatatgtgcgagccctgctggacgccgaaagacgtgtccgggagggcaagattccggtg
ccgttcgtggatagagatagcctgatggccaacgtgattcccgtaactcctccgactccg
agtgtccaagagcctgagaggggcgtggacagtaaaaaggcactgactcggcagtgttcg
ctccctactcctgatccgaaaaaggttaacgcacatcctgatgatgactctgatagtgat
gagtctattgtggacctaacgatggagggcgctgcatctctgtaa

DBGET integrated database retrieval system