KEGG   Viruses: 30855072Help
Entry
30855072          CDS       T40000                                 

Gene name
BWV06_gp060
Definition
(RefSeq) Cynomolgus cytomegalovirus; Cy89
  KO
K22773  Betaherpesvirinae envelope glycoprotein B
Taxonomy
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus; unclassified Cytomegalovirus
Taxonomy
Organism
vg  Viruses (Cynomolgus cytomegalovirus)
SSDB OrthologParalogGFIT
Motif
Pfam: Glycoprotein_B Glycoprot_B_PH1 Glycoprot_B_PH2 MFS_1 Phage_holin_3_6 DUF4763
Motif
Other DBs
NCBI-GeneID: 30855072
NCBI-ProteinID: YP_009337505
RS: NC_033176
UniProt: A0A1L6Z1B7
LinkDB All DBs
Position
NC_033176:complement(76718..79267)
AA seq 849 aa AA seqDB search
MSKNWFPLLCASVLVVYVAIASSSTGTASAVTPAPTENTTGEIIANTTLRTHEVFRVNMS
KFPYRVCSMAQGTDLLRFEQNIRCDSFKPTKEDFDEGIMVVYKRDIKPYTFKVHIYQKIL
TFRQSYSFIRENHLLGFSQERLAVPMWEVSYINRLNRCYNSVVRNVAGVTYVNYHKDSYV
NETMHLIEDDYSNTHSARYVTVKELWHKAGSTWLYTTSCNVNCMVTVTTARSKYPYDFFV
TSGGEVVDISPFYNGSNNEHFGENRDKFFIRRNYSMVESYGKDNAPLVAHELVAFFERPD
MLMSWDIVDEANNTCEYTFWEQSERTIRSEADETFHFTSHSMTATFLTLKKELNESDSDF
DCIRDEANERLEKIFNTTYNETYVKSGNVSVYETSGGLIVFWLPVKEKAIWEMQKLATEH
ANNTNATRRRKRSTNSGNSTKEVLQSVVYAQLQFTYDTLRNYINRALRQIAEAWCKDQKR
TLEVLKELSKINPSAMLSAIYDKPIAARFVGDVISLAKCVEVDQNSVQVLRDMHTKEKGL
CYSRPVVLYTFVNSSHVQYGQLGEDNEILLGRYRTEACESPSLKIFIAGNSSYEYVDYLY
KRMIPLDSISTVDTMISLDIDPLENTDFRALELYSRDELRSSNVFDLEDIMREFNTYKQR
MVHVEGKVFDNVPAYLRGLDDMMSGLGSAGKALGVAIGAVGGAVASFVEGVVGFIKNPFG
SFTVILFLLAVLGVIYLIYMRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKE
KAASATKEFSLEEAYQMLLALQKLDQEKRRQAEADDEDFASNGQSAGFLDRLRYRRRGGY
QKIQNEYEV
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaattggttcccgcttctctgtgctagcgtattggttgtgtatgttgcaatt
gcatctagcagtaccggtaccgctagtgctgtaacacctgcgcctactgaaaacaccacg
ggcgagataatcgctaatacaacattgagaactcatgaagtcttcagggttaacatgtca
aaatttccatatcgtgtgtgctcgatggctcagggaacggatcttcttcgtttcgaacag
aacattcgatgtgatagtttcaaacctacaaaggaagattttgatgaaggcatcatggtg
gtctacaagcgtgatattaagccatatacgttcaaggtgcacatctaccagaagattttg
acatttcgccagagttactcttttatcagggaaaatcacctgctgggattcagtcaagaa
cgcctagctgtaccaatgtgggaagttagttatattaatagattaaataggtgttacaat
tctgtggttagaaatgtggcaggtgttacttatgtaaattatcataaagacagttatgtt
aatgaaactatgcatctgattgaagatgattactccaacacacacagtgcccgttacgta
actgtaaaggaactttggcacaaagccggcagtacttggttgtatacaacaagctgcaat
gtaaattgcatggtaaccgtaactacagctagatctaagtatccctatgatttctttgtg
acatctggtggtgaagttgtggacatttctcctttttacaatggatctaataacgaacac
tttggagaaaatagggacaaattttttatcagaagaaattattctatggttgaatcatat
ggaaaagataacgctccattggttgctcatgaactggtggctttctttgaaaggccagat
atgcttatgtcgtgggacattgtggatgaagccaacaacacatgcgagtacacgttttgg
gagcaatcggaacgtacaattagatcagaggctgatgagacttttcattttacgtctcac
agtatgaccgccacttttttaacgttaaagaaggaattgaacgagtctgattctgatttt
gattgtattagagatgaagctaatgagcgattggagaaaatttttaacactacgtacaat
gaaacatatgtgaagtcaggcaatgtatctgtatatgaaactagtggtggattaattgtg
ttttggttgcctgtaaaagaaaaggccatttgggaaatgcagaaactggccactgaacat
gccaacaatacaaatgctactcgtcgtagaaaacgttctacaaattcaggaaactctacc
aaagaggtgcttcagagcgttgtctatgctcaattacagtttacctatgatacgttgaga
aattacattaatcgtgctctcaggcaaattgctgaagcatggtgcaaggatcaaaagaga
acattggaagtgttgaaagaacttagcaaaatcaatcccagtgctatgttatctgccatt
tacgataaacccattgctgcacgttttgttggggatgttatcagcttggctaagtgtgtg
gaggtggatcaaaatagtgttcaggtactgcgtgatatgcatacaaaggagaaaggtctt
tgctactctcggcctgtagttttgtacacttttgtaaacagttcccatgtccagtatggt
cagctgggtgaagataatgaaattttgctcggtcggtatcgtacagaagcttgtgaatct
cccagtctgaaaatttttattgccggtaattcttcatatgaatacgtggactatctgtac
aaaagaatgattcctctggacagtatttccaccgtggacaccatgatttctctggacatt
gatccgttggaaaacaccgatttcagagctttggaattgtactctcgagacgagttgcgt
tctagcaatgtttttgatctagaagacataatgcgagagttcaatacgtacaaacagcgc
atggtccacgtggaaggaaaggtgttcgacaacgtgcctgcatatcttcgtggcctggat
gacatgatgagcggcctaggttctgcagggaaggctttgggtgtggccatcggagctgta
ggtggtgctgtggcttcttttgtggaaggcgtcgtcggtttcatcaagaatcccttcggt
tctttcactgtcattctctttttgcttgcggtactgggtgttatttacttgatctacatg
cggcaaaagcgcgcgtacgagaagcccttcgagcactttttcccgtatgtcgttccacca
accacggtgaaggaagctccgccttcgtatgaacaaagccagtatgaaaacataaaagag
aaagcagcctccgcaaccaaggaattcagtttagaggaggcctatcagatgcttttggct
ttgcaaaaactggatcaagaaaaacgcagacaagcagaagcggatgacgaagatttcgca
tcgaacggtcaatccgccggcttcttggaccgcttgcgctacaggcggcgagggggctac
caaaagattcagaacgagtacgaggtctga

DBGET integrated database retrieval system