KEGG   Viruses: 30855088
Entry
30855088          CDS       T40000                                 

Gene name
BWV06_gp076
Definition
(RefSeq) Cynomolgus cytomegalovirus; Cy110
  KO
K22779  Cytomegalovirus tegument protein pp71
Taxonomy
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus; unclassified Cytomegalovirus
Organism
vg  Viruses (Cynomolgus cytomegalovirus)
SSDB
Motif
Pfam: Herpes_UL82_83
Other DBs
NCBI-GeneID: 30855088
NCBI-ProteinID: YP_009337521
RS: NC_033176
UniProt: A0A1L6YZV8
LinkDB
Position
NC_033176:complement(106492..108141)
AA seq 549 aa
MDRPPEEEEEPRPSTSRALAPAVTFERLTCQILRLVCTQHSPLEIDAVQTMNWHTSVEVA
NRAVICAFQEMKSSRDALQLTDLNLKGHCSSTFRDSLRTDACNYANRRLSPGSQTSAMLV
FALPVVRVPVTGIHLFRGRGNSQNRPPRANARTTIRRAQYTWTVKVNVSAITWTRKRDQY
VEGGYTFTTDFTFLTGLIPLTLVDAIDQLACSNGETYVQKAETIGEENVILVSLVHFSLH
PPTEVFLQLSVYAHRAEVMWRHNPNPFFERHSENGFLMKCPLNVTIPPHQTYVVQFNNAL
ETQDTCLAVFFPLELPGISMDAGPLPNRTKITVNVQNLTANAITLAHMQMLGFIHLFRRG
SVGVLPNKTETPRCSQIRLRAGLVPRDSILRGISEFAQQSNNSSSSEDEEEEGPPITPPI
ITEAIFDPFQTEDSSEDEDDEPQTTMDRLRRETQKAKREGTTPPMTHRERLPKTAMLLVV
PSWNLYIHPDLLLPLTARIAEEAVKNTSYLRSELDGDICTAADLKTTLQALAQIPGRRSP
SGRPQRPRI
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggatcgccctcccgaggaagaagaagagcccaggccgtctacctctcgagccctcgcc
ccggccgtcaccttcgaacgcctcacctgccaaatcctgcgtctcgtctgcacgcaacac
agcccgctggaaatcgatgccgtgcagacgatgaactggcacacctcagtggaggtggcc
aatcgggccgtcatctgcgcttttcaagaaatgaagtcctctcgcgacgcgttgcagctt
acggacctaaatctcaaggggcactgcagttctacgttccgagactcgctgcgcacggac
gcgtgcaactatgccaaccggcgcctctcacccggctcgcagacgtcggctatgctggtt
ttcgcgctccctgtggtacgcgtccccgtgacaggcatccacctgttccgcggccgagga
aacagccagaatcgaccgccgagagccaacgcccgcaccaccatccgtcgagcccagtat
acctggactgtgaaggtgaatgtgagcgctatcacgtggactcgtaaacgagaccagtac
gttgaaggcggttacacgtttacgaccgactttaccttcctcacgggcctcatacctctc
accttagtagacgccatcgaccagctggcctgttccaacggtgaaacatatgttcagaaa
gccgagaccataggcgaagagaatgtgattctagtgtcgctcgtccatttctccctccac
ccacctacagaggtgtttttacaattatctgtgtacgctcaccgcgctgaagtgatgtgg
cgccacaaccccaacccgttcttcgagagacactcagaaaacggctttctcatgaaatgc
cccctgaacgtgactatcccccctcatcaaacgtacgtggtgcaattcaacaacgcgcta
gaaactcaggatacctgtctcgccgtgttctttcccctggagctcccgggaattagcatg
gacgcgggtcccctgcccaaccgcacaaaaattaccgttaacgtgcagaatttgacagct
aacgcgataaccttggctcacatgcaaatgcttggatttatccacttatttcgccgaggc
tcggtcggcgtattgcccaacaagaccgaaaccccgagatgctctcagatccgtcttcga
gcaggcttagttcccagagactccattttacgcggcatctccgaattcgcccagcaatcc
aacaattcgtcttccagcgaagacgaggaggaagaaggccctccaattactcctcctatt
atcacggaggccatctttgaccccttccaaaccgaagactcatccgaggacgaagacgac
gagccgcaaaccaccatggacagactgcgaagagaaacccaaaaagccaaacgagaaggc
accacgcctccgatgactcatcgtgagagattacccaaaacggccatgctgctagttgta
ccttcatggaatctgtatattcacccagatctgctactgcccctgaccgcccgaatagcc
gaggaggcggtgaaaaatacttcgtatctccgaagtgaactggacggagatatttgcacc
gccgccgacctcaaaaccacccttcaagccctagcacaaatccccggccgtcgctccccc
agcggccgacctcaacgaccccgaatttaa

DBGET integrated database retrieval system