KEGG   Viruses: 30855120
Entry
30855120          CDS       T40000                                 

Gene name
BWV06_gp108
Definition
(RefSeq) Cynomolgus cytomegalovirus; Cy156
  KO
K22775  Cytomegalovirus viral transcription factor IE2
Taxonomy
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus; unclassified Cytomegalovirus
Organism
vg  Viruses (Cynomolgus cytomegalovirus)
SSDB
Motif
Pfam: Herpes_IE2_3 Herpes_IE1
Other DBs
NCBI-GeneID: 30855120
NCBI-ProteinID: YP_009337553
RS: NC_033176
UniProt: A0A1L6Z128
LinkDB
Position
NC_033176:complement(join(155015..156579,158446..158630,158733..158848))
AA seq 621 aa
MESRKRKPEDETHTEETGDPEEGTSGGPSTGPSPPKHPKKDMALQEAVNLLEKMLADEEK
RLTQINLGDPLFEVTGDDTIKTLEEIIQEGDDVVGAHQLVGPPPPTPLDILAQAVSQAGI
DSSSAGMTAPTPSSMITTTAPTIGPTTTAIKVPGMEITTSLQGTPKPKSKPKPKIPAPPS
AAVAAPAPSSSTTTSSSTSSTKPAVCKPTDSMSQRKKSRKTQHPMKVIIKPPSPPTCMLK
PSEIKQEGESFIRYKGQDIQPTSGCIVISDSEEEEDTVPEVSARATSEQQGVQLKITTKM
SGASGQIPMDSSSSSSSDSECCDECAGDHFSSASTITSPVSPIHTPPPAPMMPSTSKGKT
PKAPRTKSTKRLTPLDCERVRSAMREKAGTVFKNPTVETKRGRVRADEVSRMFRETTRSL
EYKNLPFLSTNVHQLMAEAVNACKSMQVNHRGIIVTYTRTHEVKEAVDVTRVKLGKVPNL
SISTPFLVEHTMPNVYPAEVVRKTAEACASGIKQAWDLKAVQPHDMCPRSSDYRNMIIHA
ATPVDFLGSLQILVPLVQRFPKQVAIRIFTNENSNSFMLPIYDQAAKMYAVGQFEETKDE
DLANLNMAIEKAIEDMNQESQ
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggagtccaggaagagaaagcctgaggatgagacccatactgaggaaactggtgatcca
gaggaggggacttctggaggaccttctactgggccttctccaccaaaacatcctaagaag
gacatggccctgcaggaagctgttaacctgctggagaagatgctggcagatgaagagaag
aggctgactcaaatcaatctgggagaccctctgtttgaagtaactggtgatgacacaata
aagacccttgaagaaatcatccaggagggggatgatgtagttggagctcatcagctcgtt
ggtccaccacctccaacacctcttgacatcctggcccaagctgtcagtcaagcagggatt
gactctagctcagcaggaatgactgcccccaccccatcaagtatgatcaccaccactgct
cccaccattggtcccaccaccactgccatcaaagttcctggtatggaaatcactaccagt
cttcagggcacccccaaacccaagtccaagcccaagcccaagatcccagcaccaccctca
gcagcagtagcagccccagcaccatcttcctccaccaccaccagcagcagcaccagtagt
accaagccagctgtttgcaaacccactgacagtatgagtcagcgaaagaaatcacgtaag
acccaacaccccatgaaggtcattattaaaccaccctcacctcccacgtgcatgctgaag
ccatcagagattaagcaggagggtgagtctttcatcaggtacaagggccaagacatccaa
cccacctctggatgtattgtgatctcagacagtgaagaagaggaagacactgtgcctgag
gtgtctgcacgtgccacaagtgaacagcaaggtgtacaactgaaaataaccactaagatg
tccggggcatctggtcaaatacctatggatagttcctcttcctcaagcagtgactctgag
tgctgtgatgagtgtgcaggtgaccacttctcctctgccagtaccatcacatccccagtg
tcccccatccacacacctccaccagcccctatgatgcccagcacctccaagggcaagacc
cccaaggcccccagaaccaagagcaccaagaggctcacccccctggactgtgagagggtg
agaagtgctatgagggagaaggctggaactgtcttcaagaaccccaccgtggaaaccaag
cgtgggagagtaagggctgatgaagtgtcccgtatgttcagagagaccaccaggtcactg
gagtacaagaaccttcccttcctgtctactaatgtgcatcagttgatggctgaagctgtg
aatgcatgcaaaagcatgcaggtgaaccacagaggcatcattgtgacctacacccgaacc
catgaagtgaaggaagcagtggatgtgaccagagtgaaacttgggaaggtccccaacctg
agcatctctacccccttcctggtggaacacaccatgcctaatgtgtatcctgcagaagtg
gtccgcaagactgcagaagcctgtgccagtggaatcaagcaggcctgggatctgaaagcc
gtgcagccacacgatatgtgccctcggtcttcagactaccgcaacatgattattcacgca
gctaccccagtggacttcttaggatccctgcaaatcttggtaccccttgtgcagagattc
cccaagcaggtggctatcaggatcttcactaatgaaaactccaattccttcatgcttccc
atttatgatcaggcagctaagatgtatgcagtgggccagttcgaggaaaccaaggatgaa
gacttggccaacctgaacatggccattgagaaagccatcgaggacatgaaccaggaatcc
cagtga

DBGET integrated database retrieval system