KEGG   Viruses: 3190322
Entry
3190322           CDS       T40000                                 

Gene name
UL39, CeHV2gUL39
Definition
(RefSeq) Cercopithecine alphaherpesvirus 2; ribonucleotide reductase subunit 1
  KO
K19448  Simplexvirus ribonucleoside-diphosphate reductase large subunit [EC:1.17.4.1]
Taxonomy
TAX:10317
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Organism
vg  Viruses (Cercopithecine alphaherpesvirus 2)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN
Other DBs
NCBI-GeneID: 3190322
NCBI-ProteinID: YP_164482
RS: NC_006560
UniProt: Q5Y0R3
LinkDB
Position
NC_006560:85252..88179
AA seq 975 aa
MSEFRVFAAAADGAGAGEPAPTLIRHPRRFLYCDRASGVTVTADGTPSCHITDSRFVQCG
SHCAMVVDGDTGTAITTADAAPVVVSFAAPAARPGAMVSIATQTDPSAPAAPAPAPGPAP
GRQSGEGAPDTSPPAAAGPAEGDEAAGGEPPRPRSTFPVPLELNRENAEAMARFLGDAGA
RDPSLLLNYFCRCAREAGERSAGPRTFASEPDLGYREFGLLRYAIYELQRMFVDVPPMPH
DAWTPVRFADYVTQLVNKFKPLVRRSDRLYRLLGMLVHLRIRCRAVSFEGWLRSREIGLD
EELVERLRAHESQLVPFFDGLEHGPTPRLMERGLQSALKYEEFYLKKIDGWLLESVPQMY
ARIAGYLACRSDLAGRVVFGRDASWLEMFTYFFNRFYAHEIVPSTPAMLGLGTRRPYTSS
CYLVNPQTRTAHSTLAAITQDVAPILARSGGIGLCLQSFNDRPGNASIMPALKALDSIVA
AYNDQSLRPTGVTVYLEPWHSDIMAVLRMKGVLAGEEARRCDNIFSALWMPDLFFKRLIR
YLEGEKDVVWTLFSNRGGMHLSSFHGEEFEKLYLCQEEQGFGEAVPIQDVAYAIVRAAAT
TGSPFVMFKDAVNRHYIYDTQGSAIAGSNLCTEIVHPANAQQSGVCNLASVNLAECVVGR
TFDFSRLRESVRACVLMVNIMIDHTAQPTPQCRRGHDRLRSMGIGMQGLHTACLKLGLDL
ASEEFRELNRHIAEVMLLAAMQASNALCLHGARPFREFKRSVFRAGRFHWEGFPGARPRY
EGEWERLRQSMMKHGLRNSQFIALMPTVASAQLADVSEGFAPLFTNMFSKVTRDGETLRP
NTLLLRELRETFSGRRLNEVLDGLDAKQWSVERALPCLAADHPLRRFKTAFDYDQELLID
LCADRAPYVDHSQSMTLYVTERADGTLPASALVRLLAHAYKRGLKTGMYYCKVRKATNSG
VFGGDDNLVCTSCVL
NT seq 2928 nt   +upstreamnt  +downstreamnt
atgtccgagttccgcgttttcgccgccgccgccgacggggctggggccggcgagccggcc
cccaccctgattcgccacccccggcggtttctgtactgcgaccgggccagcggggtgacg
gtgacggcggacggaaccccgtcgtgccacatcaccgacagccgcttcgtgcagtgcggg
tcgcactgcgccatggtcgtcgacggggacaccgggaccgcgatcaccaccgccgacgcg
gcccccgtcgtcgtgtctttcgccgcccccgcggcccgccccggggccatggtgtcgatc
gcaacgcagaccgacccatcggcacccgcggcccctgcccccgcgcccggccccgctccg
ggccgtcagtccggggaaggggctccggacacaagcccccccgcggcggccggccccgcc
gagggggacgaggccgccggcggcgagcccccccgtccccgctcgacgttccccgtgccg
ctcgagctcaatcgcgagaacgcggaggccatggcccggttcctgggcgacgccggcgcg
cgcgaccccagcctgctcctcaactacttctgtcggtgtgcccgcgaggcgggggagcgg
agcgccgggccgcggaccttcgcctccgagcccgacctcgggtaccgcgagttcgggctg
ctgcggtacgcgatctacgagctccagcgcatgttcgtggacgtgccgcccatgccccac
gacgcgtggacgccggtccgcttcgccgactacgtcacgcagctggtgaacaagttcaag
ccgctggtgcggcgctccgaccgcctgtaccggctgctggggatgctggtccacctccgc
attcggtgtcgcgcggtctcttttgagggctggctgcggtccagggagatcgggctggac
gaggagctggtggagcggctgcgcgcccacgagagccagctggtgcccttcttcgacggc
ctggagcacggtccgacgccgcgcctcatggagcgcgggctgcagtcggccctgaagtac
gaggagttctacctgaaaaagatcgacgggtggctcctggagtccgtgccccagatgtac
gcccgcatcgccgggtacctggcgtgtcgctcggacctcgccgggcgggtcgtcttcggc
cgcgatgcctcgtggctggagatgttcacgtacttcttcaaccgcttttacgcccacgag
atcgtgccctcgacgcccgccatgctgggcctggggacccgccggccctacacgagcagc
tgctacctggtgaacccgcagacccgcacggcccactccaccctcgcggccatcacgcag
gacgtggcccccatcctggcccgcagcggcgggatcgggctgtgcctgcagagcttcaac
gaccgcccggggaacgccagcatcatgcccgccctcaaggccctggactccatcgtggcc
gcctacaacgaccagagcctgcggcccacgggcgtgaccgtgtacctggagccctggcac
agcgacatcatggccgtgctgcggatgaagggcgtgctggcgggcgaggaggcccggcgc
tgcgacaacatattcagcgccctctggatgccggacctgttcttcaagcgcctcatccgc
tatctggagggcgagaaggacgtcgtctggaccctgttcagcaacaggggcggcatgcac
ctctccagcttccacggcgaggagttcgagaagctgtacctgtgccaggaggagcagggg
ttcggggaggcggtgcccatccaggacgtggcctatgccatcgtgcgcgccgcggccacc
accggcagccccttcgtcatgttcaaggacgccgtcaaccgccactacatctacgacacc
cagggctcggccatcgcgggctccaacctctgcacggagatcgtccaccccgccaacgcc
cagcagagcggggtgtgcaacctggccagcgtcaacctggcggagtgcgtcgtcggccgg
acgttcgactttagccggctccgcgagtccgtgcgggcgtgcgtcctcatggtcaacatc
atgatcgaccacacggcccagcccacgccccagtgccgccggggacacgaccgcctgcgc
tcgatgggcatcggcatgcaggggctgcacacggcctgcctcaagctggggctcgacctc
gcctccgaggagttccgggagctcaaccgccacatcgccgaggtgatgctgctggcggcg
atgcaggccagcaacgccctgtgcctgcacggggcgcgccccttccgcgagttcaagcgc
agcgtgtttcgcgccggccgcttccactgggagggcttcccgggcgcgcgcccccggtac
gagggcgagtgggagaggctgcgccagagcatgatgaagcacgggctgcgcaacagccag
ttcatcgcgctgatgcccaccgtcgcctcggcgcagctcgccgacgtcagcgaggggttc
gcgcccctcttcaccaacatgttcagcaaggtcacgcgcgacggcgagacgctgcgcccc
aacacgctgctgctgcgggagctccgggagacgttctcgggccggcggctgaacgaggtc
ctcgacgggctcgacgccaaacagtggtcggtggagcgggcgctgccgtgcctcgccgcg
gaccaccccctgcggcggttcaagacggccttcgactacgaccaggagctgctgatcgac
ctctgcgccgaccgcgccccgtacgtggaccacagccaatcgatgacgctgtacgtcacg
gagagggcggacggcaccctccccgcctccgccctggtgcgcctgctcgcgcacgcatat
aagcggggcctgaagacgggcatgtactactgcaaggttcgcaaggcgaccaacagcggg
gttttcggcggggacgacaacctcgtctgcaccagctgcgtcctgtga

DBGET integrated database retrieval system