KEGG   Viruses: 32878696Help
Entry
32878696          CDS       T40000                                 

Gene name
CCL34_gp08
Definition
(RefSeq) Sulfolobus islandicus rod-shaped virus 10; hypothetical protein
Taxonomy
  Lineage
Viruses; dsDNA viruses, no RNA stage; Ligamenvirales; Rudiviridae; unclassified Rudiviridae
Taxonomy
Organism
vg  Viruses
SSDB OrthologParalogGFIT
Motif
Pfam: Cas_Cas4 PDDEXK_1 Exo5 DUF4979
Motif
Other DBs
NCBI-GeneID: 32878696
NCBI-ProteinID: YP_009362792
RS: NC_034625
LinkDB All DBs
Position
NC_034625:complement(4087..4704)
AA seq 205 aa AA seqDB search
MTNYEEFVKQSFKMKYPEDTIFPSEIGICFRKSYFSRKFEFEKAVNEITLDLGEQYHEKV
EHYFQEKLNCKAEIEIKGEIENIKISGRIDLICNNDLIELKTITSNYFNIKEYHLYQVSI
YYYLLQQQNYKIDNVYIIYLNRINKEVRQFQIDKKVLDEYMKKTIDWIKKFKEFMKSQDY
KTIPGANNYLCKNCEFKAKCFGSLF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattatgaagaatttgtaaaacaaagttttaaaatgaaatatccagaagataca
atatttccatcagaaattggaatttgttttagaaaaagctattttagtagaaaatttgaa
tttgagaaagccgtaaatgaaattactttagacctaggagaacaatatcatgaaaaagta
gaacattattttcaagaaaaactaaattgtaaagcagaaattgaaataaaaggagaaatt
gaaaatataaaaatttctggaagaattgacttaatttgtaataatgatcttatagaactt
aaaactatcacaagtaactatttcaatataaaggaatatcatctttaccaagtctcaatt
tactattatttactacaacaacaaaactataaaattgataacgtatacattatatattta
aatagaataaataaagaagttagacaatttcaaatagacaaaaaagtattagatgaatat
atgaaaaagacaattgactggattaagaaatttaaagaatttatgaaatcacaagattat
aaaactataccaggagcaaataattatttatgtaaaaattgtgaatttaaagcaaaatgt
tttggctctttattctga

DBGET integrated database retrieval system