KEGG   Viruses: 3655156Help
Entry
3655156           CDS       T40000                                 

Gene name
NS1, FLUAVH3N2_s8p2
Definition
(RefSeq) Influenza A virus (A/New York/392/2004(H3N2)); nonstructural protein 1
  KO
K19396  Influenza A virus non-structural protein 1
Taxonomy
TAX:335341 [GN:T40037]
  Lineage
Viruses; ssRNA viruses; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H3N2 subtype
Taxonomy
Organism
vg  Viruses (Influenza A virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Flu_NS1
Motif
Other DBs
NCBI-GeneID: 3655156
NCBI-ProteinID: YP_308845
RS: NC_007370
UniProt: Q464B3
LinkDB All DBs
Position
NC_007370:27..719
AA seq 230 aa AA seqDB search
MDSNTVSSFQVDCFLWHIRKQVVDQELSDAPFLDRLRRDQRSLRGRGNTLGLDIKAATHV
GKQIVEKILKEESDEALKMTMVSTPASRYITDMTIEELSRNWFMLMPKQKVEGPLCIRMD
QAIMEKNIMLKANFSVIFDRLETIVLLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGV
LIGGLEWNDNTVRVSKNLQRFAWRSSNENGGPPLTPKQKRKMARTARSKV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggattccaacactgtgtcaagtttccaggtagattgctttctttggcatatccggaaa
caagttgtagaccaagaactgagtgatgccccattccttgatcggcttcgccgagatcag
aggtccctaaggggaagaggcaatactctcggtctagacatcaaagcagccacccatgtt
ggaaagcaaattgtagaaaagattctgaaagaagaatctgatgaggcacttaaaatgacc
atggtctccacacctgcttcgcgatacataactgacatgactattgaggaattgtcaaga
aactggttcatgctaatgcccaagcagaaagtggaaggacctctttgcatcagaatggac
caggcaatcatggagaaaaacatcatgttgaaagcgaatttcagtgtgatttttgaccga
ctagagaccatagtattactaagggctttcaccgaagagggagcaattgttggcgaaatc
tcaccattgccttcttttccaggacatactattgaggatgtcaaaaatgcaattggggtc
ctcatcggaggacttgaatggaatgataacacagttcgagtctctaaaaatctacagaga
ttcgcttggagaagcagtaatgagaatgggggacctccacttactccaaaacagaaacgg
aaaatggcgagaacagctaggtcaaaagtttga

DBGET integrated database retrieval system