KEGG   Viruses: 3707592
Entry
3707592           CDS       T40000                                 

Gene name
E3L, VACWR059
Definition
(RefSeq) Vaccinia virus; double-strand RNA-binding protein
  KO
K12969  Vaccinia virus protein E3
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: z-alpha dsrm RPA_C RNA_pol_Rpc34
Other DBs
NCBI-GeneID: 3707592
NCBI-ProteinID: YP_232941
RS: NC_006998
UniProt: P21605
LinkDB
Structure
PDB: 
1OYI

Position
NC_006998:complement(47780..48352)
AA seq 190 aa
MSKIYIDERSNAEIVCEAIKTIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSD
DIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKGANPVT
VINEYCQITRRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVD
KLLGYVIIRF
NT seq 573 nt   +upstreamnt  +downstreamnt
atgtctaaaatctatatcgacgagcgttctaacgcagagattgtgtgtgaggctattaaa
accattggaatcgaaggagctactgctgcacaactaactagacaacttaatatggagaag
cgagaagttaataaagctctgtacgatcttcaacgtagtgctatggtgtacagctccgac
gatattcctcctcgttggtttatgacaacggaggcggataagccggatgctgatgctatg
gctgacgtcataatagatgatgtatcccgcgaaaaatcaatgagagaggatcataagtct
tttgatgatgttattccggctaaaaaaattattgattggaaaggtgctaaccctgtcacc
gttattaatgagtactgccaaattactaggagagattggtcttttcgtattgaatcagtg
gggcctagtaactctcctacattttatgcctgtgtagacatcgacggaagagtattcgat
aaggcagatggaaaatctaaacgagatgctaaaaataatgcagctaaattggcagtagat
aaacttcttggttacgtcatcattagattctga

DBGET integrated database retrieval system