KEGG   Viruses: 3850222
Entry
3850222           CDS       T40000                                 

Gene name
UL39, CeHV16_gp41
Definition
(RefSeq) Papiine alphaherpesvirus 2; ribonucleotide reductase subunit 1
  KO
K19448  Simplexvirus ribonucleoside-diphosphate reductase large subunit [EC:1.17.4.1]
Taxonomy
TAX:340907
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Organism
vg  Viruses (Papiine alphaherpesvirus 2)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN
Other DBs
NCBI-GeneID: 3850222
NCBI-ProteinID: YP_443886
RS: NC_007653
UniProt: Q2QBD7
LinkDB
Position
NC_007653:87225..90185
AA seq 986 aa
MSEFRVSAADGAPADEPAPTPIRQPRRFLYFDRASGVTVAADGTPSCHITDSRFVQCGSN
CAMVVGGTTGSATTATGADPDARAEVAVVSFVAPPVRPGAMVSIATQTDPLPPAAPAPTP
TPGPTPAPDSGEEAPDARPSSVPGGPAAAGGPDDEPADDEPPRPPSAFPVPLELTHENAE
AMARFLGDAGERDPTLLLNYFCRCAREAEERSAGPRTFAAEPTLGYREFGLLRYAIYELQ
RMCVDVPPMPHAAWTPVRFADYATQLVNKFKPLVRRSDRLYRLLGMLVHLRIRCRSVSFE
WWLRSREIGLDEELVERLRAHESQLVPFFEGLERGPTMRLMERGLQSALKYEEFYLKKID
GWLLESVPQMYARIAGYLACHADLAGRVVFGRDASWLEMFTYFFNRFYAHEIVPSTPAML
GLGTRRPYTSSCYLVNPQTRTAHSTLAAITQNVAPILARSGGIGLCLQNFNDRPGNASLM
PALKALDSIVAAYNDQSLRPTGVTVYLEPWHSDIMAVLRMKGVLAGEEARRCDNIFSALW
MPDLFFKRLIRYLEGEKNVVWTLFSHRGGMHLASFHGEEFERLYRCQEELGFGEAVPIQD
VAYAIVRAAATTGSPFVMFKDAVNRHYIYDTQGAAIAGSNLCTEIVHPANAQQSGVCNLA
SVNLAECVVGRTFDFARLRESVRACVLMVNIMIDHTAQPTPQCRRGHDRLRSMGIGMQGL
HTACLKMGLDLASEEFRELNRHIAEVMLLAAMQASNALCFHGARPFREFKRSVFRAGRFH
WEGFPDARPRYEGEWEMLRQSMMKHGLRNSQFIALMPTVASAQLADVSEGFAPLFTNMFS
KVTRDGETLRPNTLLLRELRETFSGRRLNEVIDALDAKQWSVERALPCLAADHPLRRFKT
AFEYDQELLIDLCADRAPYVDHSQSLTLHVTERADGTLPASSLVRLLVHAYKRGLKTGMY
YCKVRKATNSGVFGGDDNIVCTSCVL
NT seq 2961 nt   +upstreamnt  +downstreamnt
atgtccgagttccgcgtttccgccgccgacggggctccggccgacgagccggcgcccacc
ccgatccgccaaccccggcggtttctgtacttcgaccgggccagcggggtgacggtggcg
gcggacggaaccccgtcgtgccacatcaccgacagccgcttcgtgcagtgcggctcgaac
tgcgccatggtcgtcggcgggaccaccgggtccgcgaccaccgctaccggcgcggacccc
gacgcgcgagcggaggtggccgtcgtgtcctttgtcgcccccccggtccgccccggggcc
atggtgtcgatcgcgacgcagacggacccgctgccccccgcggcccccgccccgactccc
acccccggccccaccccggcccccgactcgggggaagaggctccggacgcgcggccctcc
tcggtgcccggcggccccgccgccgccggcgggcccgatgacgagcccgccgacgacgag
cccccccgtccgccgtcggcgttccccgtgccgctggagctcacccacgagaacgcggag
gccatggccaggttcctgggcgacgccggcgagcgcgaccccacactgctgctgaactac
ttctgtcgatgcgcccgcgaggcggaggagcggagcgccgggccgcggaccttcgccgcc
gagcccacgctcggctaccgcgagttcgggctgctgcggtacgccatctacgagctgcag
cgcatgtgcgtggacgtgccgcccatgccccacgccgcctggacgccggtccgcttcgcc
gactacgccacgcagctggtgaacaagttcaagccgctggtgcggcgctccgaccgcctg
taccggctgctggggatgctggtccacctccgcattcggtgccgctccgtctccttcgag
tggtggctgcggtccagggagatcgggctggacgaggagctggtggagcggctgcgcgcc
cacgagagccagctggtgcccttcttcgagggcctggagcgcggtccgacgatgcgcctc
atggagcgcgggctgcagtcggccctgaagtacgaggagttctacctgaagaagatcgac
gggtggctcctggagtccgtgccccagatgtacgcccgcatcgccgggtacctggcgtgc
cacgcggacctcgccgggcgggtcgtcttcggccgcgacgcctcgtggctggagatgttc
acgtacttcttcaaccgcttctacgcccacgagatcgtgccctccacgcccgccatgctg
ggcctggggacccgccggccctacacgagcagctgctacctggtgaacccgcagacccgc
acggcccactccacgctcgcggccatcacccagaacgtggcccccatcctggcccgcagc
ggcgggatcgggctgtgcctgcagaacttcaacgaccgcccggggaacgccagcctcatg
cccgccctcaaggccctggactcgatcgtggccgcctacaacgaccagagcctgcggccc
acgggcgtgaccgtgtacctggagccctggcacagcgacatcatggccgtgctgcggatg
aagggcgtgctggcgggcgaggaggcccggcgctgcgacaacatcttcagcgccctctgg
atgccggacctgttcttcaagcgcctcatccgctacctggagggcgagaagaacgtcgtc
tggaccctgttcagccaccggggcggcatgcacctcgccagcttccacggcgaggagttc
gagaggctgtaccggtgccaggaggagctggggttcggcgaggcggtgcccatccaggac
gtggcctacgccatcgtgcgcgccgcggccaccaccgggagccccttcgtcatgttcaag
gacgccgtcaaccgccactacatctacgacacccagggcgcggccatcgcgggctccaac
ctctgcacggagatcgtccacccggccaacgcccagcagagcggggtgtgcaacctggcg
agcgtcaacctggcggagtgcgttgtcggccggacgttcgacttcgcccggctccgcgag
tccgtgcgggcgtgcgtcctgatggtcaacatcatgatcgaccacacggcccagcccacc
ccccagtgccgccgcgggcacgaccgcctgcgctcgatgggcatcggcatgcaggggctg
cacaccgcctgcctcaagatggggctcgacctcgcctccgaggagttccgggagctgaac
cgccacatcgccgaggtgatgctgctggcggcgatgcaggccagcaacgccctgtgcttt
cacggggcgcgccccttccgcgagttcaagcgcagcgtgtttcgcgccgggcgcttccac
tgggagggcttcccggacgcgcgcccccggtacgagggcgagtgggagatgctgcgccag
agcatgatgaagcacgggctgcgcaacagccagttcatcgcgctgatgcccaccgtcgcc
tcggcgcagctcgcggacgtcagcgaggggttcgcgcccctcttcaccaacatgttcagc
aaggtcacgcgcgacggcgagacgctgcgccccaacacgctgctgctgcgggagctccgg
gagacgttctccggccggcggctgaacgaggtcatcgacgcgctcgacgccaagcagtgg
tcggtggagcgggcgctgccgtgcctcgccgcggaccaccccctccggcggttcaagacg
gccttcgagtacgaccaggagctgctgatcgacctctgcgccgaccgcgccccgtacgtg
gaccacagccaatcgctgacgctgcacgtcacggagagggcggacggcaccctccccgcc
tcctcgctggtgcgcctgctcgtgcacgcatataagcggggcctgaagacgggcatgtac
tactgcaaggtccgcaaggcgaccaacagcggggtcttcggcggcgacgacaacatcgtc
tgcaccagctgcgtcctgtga

DBGET integrated database retrieval system