KEGG   Viruses: 4179173Help
Entry
4179173           CDS       T40000                                 

Gene name
NANV_gp26
Definition
(RefSeq) Neodiprion abietis NPV; trypsin-like protein
Taxonomy
TAX:204507
  Lineage
Viruses; dsDNA viruses; Baculoviridae; Gammabaculovirus; unclassified Gammabaculovirus
Taxonomy
Organism
vg  Viruses (Neodiprion abietis NPV)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Toxin_4
Motif
Other DBs
NCBI-GeneID: 4179173
NCBI-ProteinID: YP_667874
RS: NC_008252
UniProt: Q0ZP54
LinkDB All DBs
Position
NC_008252:25092..25871
AA seq 259 aa AA seqDB search
MFAVFASFLIITVAVASSDESIANVSPTGRIVGGSPTSIDEIPYQVSLQVYSTHICGASI
ISDSWIVTAAHCITYPVTLYRIRSGSTLSISGGVVTQVESAYVHHAYYTNNYGIPVNDIA
LLKLTNSLILGITSAAVPLYNKNEIIPDESTAIITGWGTLTENGNTPVVLYSVNIPVIPT
STCAQIFRSWGGLPENQICAASPGGGKDACQGDSGGPMVVNDRLAGIVSWGNGCGRNGWP
GVYTEVAAYREWITSLTGI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtttttgcatcttttttaattataaccgtcgcagttgcttcgtcagatgaa
tcgattgcgaacgtttcaccgacaggtaggattgtcggaggtagtccaacatctatagac
gagattccttatcaagtatcgttacaagtgtattccacacacatatgcggtgctagtata
atatctgattcgtggatcgtaacagcagcccactgtatcacgtatccggtcactttgtac
agaatacgaagtgggtcgacgttatcaatttctggtggtgttgtaacgcaagttgaatca
gcatacgttcatcatgcgtattataccaacaattatggaattccagtaaacgacatagct
ctgttgaaactgaccaattcattaatattgggaatcacttcagcagctgtacctttgtac
aataaaaatgaaattatcccagacgaatcaaccgctattattaccggatggggtacattg
actgagaatggcaacactcctgttgtgttgtattccgtaaatataccagttattccaact
tccacgtgtgctcaaatattccgcagttggggtggtttgccagaaaatcaaatatgtgcg
gcgtcaccaggaggcggtaaagacgcgtgtcaaggtgattcgggtggaccaatggttgtt
aacgatagattggctggaatcgtgtcgtggggaaatgggtgtggtagaaatggttggcca
ggtgtttacaccgaagtggctgcgtatagggaatggataactagtttaactggtatataa

DBGET integrated database retrieval system