KEGG   Viruses: 4397483
Entry
4397483           CDS       T40000                                 

Gene name
stx2A, Stx2-86_gp01
Definition
(RefSeq) Stx2-converting phage 86; Shiga toxin Stx2c subunit A
  KO
K11006  shiga toxin subunit A
Taxonomy
TAX:379329
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Traversvirus; unclassified Traversvirus
Organism
vg  Viruses (Stx2-converting phage 86)
SSDB
Motif
Pfam: RIP
Other DBs
NCBI-GeneID: 4397483
NCBI-ProteinID: YP_794048
RS: NC_008464
UniProt: Q08JA4
LinkDB
Position
NC_008464:1..960
AA seq 319 aa
MKCILFKWVLCLLLGFSSVSYSREFTIDFSTQQSYVSSLNSIRTEISTPLEHISQGTTSV
SVINHTPPGSYFAVDIRGLDVYQARFDHLRLIIEQNNLYVAGFVNTATNTFYRFSDFTHI
SVPGVTTVSMTTDSSYTTLQRVAALERSGMQISRHSLVSSYLALMEFSGNTMTRDASRAV
LRFVTVTAEALRFRQIQREFRQALSETAPVYTMTPGDVDLTLNWGRISNVLPEYRGEDGV
RVGRISFNNISAILGTVAVILNCHHQGARSVRAVNEESQPECQITGDRPVIKINNTLWES
NTAAAFLNRKSQFLYTTGK
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaagtgtatattatttaaatgggtactgtgcctgttactgggtttttcttcggtatcc
tattcccgggagtttacgatagacttttcgacccaacaaagttatgtctcttcgttaaat
agtatacggacagagatatcgacccctcttgaacatatatctcaggggaccacatcggtg
tctgttattaaccacaccccaccgggcagttattttgctgtggatatacgagggcttgat
gtctatcaggcgcgttttgaccatcttcgtctgattattgagcaaaataatttatatgtg
gccgggttcgttaatacggcaacaaatactttctaccgtttttcagattttacacatata
tcagtgcccggtgtgacaacggtttccatgacaacggacagcagttataccactctgcaa
cgtgtcgcagcgctggaacgttccggaatgcaaatcagtcgtcactcactggtttcatca
tatctggcgttaatggagttcagtggtaatacaatgaccagagatgcatccagagcagtt
ctgcgttttgtcactgtcacagcagaagccttacgcttcaggcagatacagagagaattt
cgtcaggcactgtctgaaactgctcctgtgtatacgatgacgccgggagacgtggacctc
actctgaactgggggcgaatcagcaatgtgcttccggagtatcggggagaggatggtgtc
agagtggggagaatatcctttaataatatatcagcgatactggggactgtggccgttata
ctgaattgccatcatcagggggcgcgttctgttcgcgccgtgaatgaagagagtcaacca
gaatgtcagataactggcgacaggcctgttataaaaataaacaatacattatgggaaagt
aatacagctgcagcgtttctgaacagaaagtcacagtttttatatacaacgggtaaataa

DBGET integrated database retrieval system