KEGG   Viruses: 4397484
Entry
4397484           CDS       T40000                                 

Gene name
stx2B, Stx2-86_gp02
Definition
(RefSeq) Stx2-converting phage 86; Shiga toxin Stx2a subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
TAX:379329
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Traversvirus; unclassified Traversvirus
Organism
vg  Viruses (Stx2-converting phage 86)
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 Porin_7 PCC_BT
Other DBs
NCBI-GeneID: 4397484
NCBI-ProteinID: YP_794049
RS: NC_008464
UniProt: Q08JA3
LinkDB
Position
NC_008464:972..1241
AA seq 89 aa
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system