KEGG   Viruses: 4961436
Entry
4961436           CDS       T40000                                 

Gene name
K4.1, HHV8GK18_gp15
Definition
(RefSeq) Human gammaherpesvirus 8; K4.1
  KO
K21658  KSHV protein vCCL3
Taxonomy
TAX:37296 [GN:T40081]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Rhadinovirus
Organism
vg  Viruses (Human gammaherpesvirus 8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 4961436
NCBI-ProteinID: YP_001129363
RS: NC_009333
UniProt: F5HCJ2 P88968
LinkDB
Position
NC_009333:complement(22117..22461)
AA seq 114 aa
MWSMCWVLRAHLGLLFWVAVIELCAASGPATIMASDCCENSLSSARLPPDKLICGWYWTS
TVYCRQKAVIFVTHSGRKVCGSPAKRRTRLLMEKHTEIPLAKRVALRAGKGLCP
NT seq 345 nt   +upstreamnt  +downstreamnt
atgtggagcatgtgctgggtgttgcgcgcacatttggggctgctcttctgggtggccgtg
attgagctatgtgcggccagcggtcctgccaccatcatggcctcggattgttgcgagaat
tccctgtccagtgccagattgccaccggataagctgatatgcgggtggtactggacgtcc
accgtgtattgtcgccagaaggcagtcatttttgtaacgcactcggggcggaaagtatgc
gggtcgcctgcgaagcggcgcacgcgtcttctgatggagaagcacacggagatacctctc
gcgaagcgcgtagcgcttcgcgccggtaaagggttatgcccctag

DBGET integrated database retrieval system