KEGG   Viruses: 4961464Help
Entry
4961464           CDS       T40000                                 

Gene name
vIRF-1, HHV8GK18_gp62
Definition
(RefSeq) Human gammaherpesvirus 8; K9
  KO
K21653  KSHV interferon regulatory factor-like protein 1
Taxonomy
TAX:37296 [GN:T40081]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Rhadinovirus
Taxonomy
Organism
vg  Viruses (Human gammaherpesvirus 8)
SSDB OrthologParalogGFIT
Motif
Pfam: IRF-3 IRF COX5B
Motif
Other DBs
NCBI-GeneID: 4961464
NCBI-ProteinID: YP_001129411
RS: NC_009333
UniProt: F5HF68 Q77Q82
LinkDB All DBs
Structure
PDB: 

Position
NC_009333:complement(83960..85309)
AA seq 449 aa AA seqDB search
MDPGQRPNPFGAPGAIPKKPCLSQGSPGTSGSGAPCDEPSRSESPGEGPSGTGGSAAAGD
ITRQAVVAAITEWSRTRQLRISTGASEGKASIKDWIVCQVNSGKFPGVEWEDEERTRFRI
PVTPLADPCFEWRRDGELGVVYIRERGNMPVDASFKGTRGRRRMLAALRRTRGLQEIGKG
ISQDGHHFLVFRVRKPEEEQCVECGVVAGAVHDFNNMARLLQEGFFSPGQCLPGEIVTPV
PSCTTAEGQEAVIDWGRLFIRMYYNGEQVHELLTTSQSGCRISSALRRDPAVHYCAVGSP
GQVWLPNVPNLACEIAKRELCDTLDACAKGILLTSSCNGIFCVCYHNGPVHFIGNTVPPD
SGPLLLPQGKPTRIFNPNTFLVGLANSPLPAPSHVTCPLVKLWLGKPVAVGKLEPHAPSP
RDFAARCSNFSDACVVLEIMPKPLWDAMQ
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggacccaggccaaagaccgaacccttttggggcgcctggggcgatacccaaaaaacct
tgtttgtcacaagggtcaccgggaacatctggctccggggctccttgcgatgaaccatcc
aggtcggagtcaccgggagaaggaccctccgggaccgggggttctgcagccgcaggcgat
attacacggcaggctgtggtggctgcgataacggagtggagccggacacgacaactaaga
atatctaccggtgccagtgaggggaaagcgtcaatcaaggattggatagtatgtcaagtc
aacagtggaaaatttcccggagtagagtgggaagacgaagagcgcacccgcttccgtata
ccagttacgcccctcgcggacccctgttttgaatggcgcagagacggggaattgggtgtt
gtgtatatccgcgaaaggggtaacatgcccgtggacgcctcgtttaaaggcaccaggggg
cgcaggcgaatgcttgccgcgctacgcaggacgcggggtttacaagagattggcaaaggc
atttctcaggatggacaccattttctggtctttagagtacgtaaaccggaggaagaacaa
tgcgtggaatgtggagtcgtggccggagccgtccacgattttaacaatatggcacgtctc
ttgcaagagggatttttttccccggggcagtgcttgccaggcgagattgtaacgcccgtg
ccatcttgtacgacggcagagggtcaggaggccgtcattgactggggtcggttgtttatc
aggatgtattataatggcgaacaggttcatgagttactgacgacaagccagtcgggctgt
cgaatctcatcggccttgcgtagggaccccgcagttcattactgtgcagtggggtctccg
ggccaggtatggctacccaatgtgccaaacctggcctgcgagatagccaagcgggagcta
tgcgatacgctggacgcatgtgcaaaaggcattctgctgactagctcttgtaatggcata
ttttgcgtatgttatcataacgggcccgtgcactttattggaaataccgttccgcctgac
tccggccccctcttgctgccccagggaaaaccgacgaggatatttaacccgaatacattt
ctggtggggttggcaaattcaccgttaccagcaccctctcacgtgacgtgtcctttggtg
aagctgtggctggggaaaccggtggcggttggcaagttagagccccacgccccgtccccg
cgagactttgcggcgaggtgcagtaatttctcagacgcctgcgtcgtactcgaaataatg
ccgaagccgttatgggatgccatgcaataa

DBGET integrated database retrieval system