KEGG   Viruses: 4961493Help
Entry
4961493           CDS       T40000                                 

Gene name
vIRF-3, HHV8GK18_gp64
Definition
(RefSeq) Human gammaherpesvirus 8; vIRF-3
  KO
K21652  KSHV interferon regulatory factor-like protein 3
Taxonomy
TAX:37296 [GN:T40081]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Rhadinovirus
Taxonomy
Organism
vg  Viruses
SSDB OrthologParalogGFIT
Motif
Pfam: IRF-3
Motif
Other DBs
NCBI-GeneID: 4961493
NCBI-ProteinID: YP_001129413
RS: NC_009333
UniProt: F5HIC6 Q9DUN1
LinkDB All DBs
Position
NC_009333:complement(join(89700..90945,91042..91496))
AA seq 566 aa AA seqDB search
MAGRRLTWISEFIVGALDSDKYPLVKWLDRSTGTFLAPAARNDVIPLDSLQFFIDFKREC
LSKGLHPRDLLGSPITAFGKICTTSRRLRRLPGEEYEVVQGINCRRWRLLCAEVKECWWC
VHARTHLHSGSSLWEILYQHSVRLEKHRRRPRPFVGENSDSSEEDHPAFCDVPVTQTGAE
SEDSGDEGPSTRHSASGVQPVDDANADSPGSGDEGPSTRHSDSQPPPADETTVHTDNVED
DLTLLDKESACALMYHVGQEMDMLMRAMCDEDLFDLLGIPEDVIATSQPGGDTDASGVVT
EGSIAASAVGAGVEDVYLAGALEAQNVAGEYVLEISDEEVDDGAGLPPASRRRPVVGEFL
WDDGPRRHERPTTRRIRHRKLRSAYYRVARPPVMITDRLGVEVFYFGRPAMSLEVERKVF
ILCSQNPLADISHSCLHSRKGLRVLLPKPDDNNTGPGDVNLLAAVLRSFASGLVIVSLRS
GIYVKNLCKSTVLYHGNNPPKKFGVICGLSSRAVLDVFNVAQYRIQGHEHIKKTTVFIGG
DPTSAEQFDMVPLVIKLRLRSVTCDD
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacgcaggcttacctggatttctgagtttattgtaggtgctttggactctgat
aaatatcctttggtcaagtggctagatagatctactggaacatttcttgctccggctgcc
cgtaatgacgtaattcctctggatagcctacagtttttcattgattttaagagggaatgc
ctatcgaagggcctgcatcccagagatttactgggctcgccgattacggcttttgggaaa
atatgtaccacgtcgcggcgccttagacgcttgccaggtgaagagtacgaggtcgtacag
ggaattaattgtagaaggtggcgcctcctgtgtgccgaggtaaaggaatgctggtggtgc
gttcatgccaggactcacctacacagtgggtcatcactatgggaaattttgtatcaacac
agtgtacggctcgagaagcatcggagaagaccaaggccatttgtgggtgaaaactcggat
tccagtgaggaggatcacccagccttttgcgatgtgccggtcacgcagacgggcgcggaa
tctgaggactctggagacgagggaccatcgacgcgccatagtgcgtctggggttcagcca
gttgatgatgccaatgccgactctcctggctctggagacgaaggaccctcgacgcgtcat
agcgactcgcagccccccccggccgatgaaacaacggtgcacacagacaacgttgaagat
gacctcacactgcttgataaagaatctgcatgtgcattgatgtaccacgtgggacaggag
atggacatgctaatgagggcgatgtgcgatgaagacctctttgatctgcttggcatccca
gaggatgttatcgcaacatcacagcccggaggcgacacggatgcaagcggcgtggtaaca
gagggctcaatcgccgcctcggctgtcggggcgggtgtagaggatgtgtacttagctggg
gcactcgaggcccagaatgtagcaggggaatatgtgttggagataagtgacgaagaagtc
gatgatggtgctggactgccgccggcgtccagacgccggccagttgttggcgaattttta
tgggatgatgggccacggagacacgagaggcctaccacgaggcgcattcgccacaggaag
cttagatccgcatattatagagtggcacggccgccagtaatgataaccgataggcttggt
gtggaagtgttttattttggccgccctgcaatgtctttggaagtggaacgaaaggtgttt
attctatgttcccagaacccactggcagacattagccactcttgcttgcattcgcgcaaa
gggttaagagttttgttgcccaaacctgacgacaataacacagggccaggagacgttaac
ctgctggcggccgtgctgcgctcgtttgcttcgggtcttgtgatagtttctctccgatct
ggcatttatgttaagaatttgtgcaagtctaccgtattatatcatggaaataatcctcca
aagaagtttggtgtgatctgcggactgtcatctagggctgttctggatgtttttaatgtg
gcacaatatcgcatacagggacatgagcacattaaaaaaacaactgtgttcatcggaggt
gacccaacgtcggcagaacagttcgatatggtccccctcgtcatcaagctcagattgcgt
tcagttacatgtgatgactaa

DBGET integrated database retrieval system