KEGG   Viruses: 4961510
Entry
4961510           CDS       T40000                                 

Gene name
K6, HHV8GK18_gp17
Definition
(RefSeq) Human gammaherpesvirus 8; K6
  KO
K21659  KSHV protein K6
Taxonomy
TAX:37296 [GN:T40081]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Rhadinovirus
Organism
vg  Viruses (Human gammaherpesvirus 8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 4961510
NCBI-ProteinID: YP_001129366
RS: NC_009333
UniProt: F5HET8 Q76RJ0
LinkDB
Structure
PDB: 
1ZXT

Position
NC_009333:complement(27289..27576)
AA seq 95 aa
MAPVHVLCCVSVLLATFYLTPTESAGSLVSYTPNSCCYGFQQHPPPVQILKEWYPTSPAC
PKPGVILLTKRGRQICADPSKNWVRQLMQRLPAIA
NT seq 288 nt   +upstreamnt  +downstreamnt
atggcccccgtccacgttttatgctgcgttagcgtactgcttgccacgttttacctgacg
cccacagaaagcgcggggtcactcgtgtcgtacacgcctaatagctgctgctacgggttc
cagcagcacccaccgcccgtccaaattctaaaagagtggtatcccacgtccccagcgtgc
ccaaaacccggagttattttgctgaccaagcgagggcgtcagatctgcgcagacccttcc
aaaaactgggttaggcagctgatgcagcggctgcctgccatagcttag

DBGET integrated database retrieval system