KEGG   Viruses: 4961514
Entry
4961514           CDS       T40000                                 

Gene name
K4, HHV8GK18_gp13
Definition
(RefSeq) Human gammaherpesvirus 8; K4
  KO
K21657  KSHV macrophage inflammatory protein 2
Taxonomy
TAX:37296 [GN:T40081]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Rhadinovirus
Organism
vg  Viruses (Human gammaherpesvirus 8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 4961514
NCBI-ProteinID: YP_001129362
RS: NC_009333
UniProt: Q98157 F5HFL9
LinkDB
Structure
PDB: 
1CM9 4RWS 1HFN 1HFG 1VMP

Position
NC_009333:complement(21480..21764)
AA seq 94 aa
MDTKGILLVAVLTALLCLQSGDTLGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSK
PGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR
NT seq 285 nt   +upstreamnt  +downstreamnt
atggacaccaagggcatcctgctcgtcgctgtgctgactgccttgctttgtttgcaatct
ggggacacgctgggagcgtcctggcatagaccggacaagtgctgtctcggttaccagaaa
agaccattaccacaggtgcttctgtccagctggtaccccacctcccaactgtgcagcaag
ccgggtgtgatatttttgacaaagcgtggtcgccaggtgtgtgccgacaaatcgaaagac
tgggtgaagaagctgatgcagcaattaccagtcactgctcgctga

DBGET integrated database retrieval system