KEGG   Viruses: 5955747Help
Entry
5955747           CDS       T40000                                 

Gene name
sodC, STM1044.Gifsy2
Definition
(RefSeq) Phage Gifsy-2; bacteriophage virulence determinant; superoxide dismutase precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Taxonomy
TAX:129862
  Lineage
Viruses; Other viruses; unclassified bacterial viruses
Taxonomy
Organism
vg  Viruses (Phage Gifsy-2)
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 5955747
NCBI-ProteinID: YP_001700689
RS: NC_010393
LinkDB All DBs
Position
NC_010393:complement(31867..32400)
AA seq 177 aa AA seqDB search
MKYTILSLVAGALISCSAMAENTLTVKMNDALSSGTGENIGEITVSETPYGLLFTPHLNG
LTPGIHGFHVHTNPSCMPGMKDGKEVPALMAGGHLDPEKTGKHLGPYNDKGHLGDLPGLV
VNADGTATYPLLAPRLKSLSELKGHSLMIHKGGDNYSDKPAPLGGGGARFACGVIEK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacacaatattgtcgctggtagctggtgcgctcatcagttgttcagcaatggca
gagaataccctgactgtaaagatgaacgatgccctgtccagcggaacaggagaaaacata
ggtgaaatcacagtttcagagacaccttacggtctgcttttcactcctcacctaaatggt
cttacgccaggaattcacggcttccatgtccacacaaacccaagttgtatgccgggaatg
aaagacggtaaagaggttccggcgctcatggccggaggacatcttgaccccgaaaaaacc
gggaaacatcttggcccatataatgacaaagggcatttgggggatctgcctggactggtt
gtcaatgcagatggtacagccacgtatccgttactggcaccacgccttaaatcactgtca
gaactgaaaggtcactcattgatgatccataaaggcggtgacaattactccgataaacct
gctccactgggtggtggcggtgcacgttttgcctgtggtgtcattgagaaataa

DBGET integrated database retrieval system