KEGG   Viruses: 6159351
Entry
6159351           CDS       T40000                                 

Gene name
stx2B, pMIN27_42
Definition
(RefSeq) Escherichia phage Min27; Shiga toxin Stx2a subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
TAX:489779
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Traversvirus; Escherichia virus Min27
Organism
vg  Viruses (Escherichia virus Min27)
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 Porin_7 PCC_BT
Other DBs
NCBI-GeneID: 6159351
NCBI-ProteinID: YP_001648933
RS: NC_010237
UniProt: B0FEE1
LinkDB
Position
NC_010237:24138..24407
AA seq 89 aa
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system