KEGG   Viruses: 6159405
Entry
6159405           CDS       T40000                                 

Gene name
stx2A, pMIN27_41
Definition
(RefSeq) Escherichia phage Min27; Shiga toxin Stx2c subunit A
  KO
K11006  shiga toxin subunit A
Taxonomy
TAX:489779
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Sepvirinae; Traversvirus; Escherichia virus Min27
Organism
vg  Viruses (Escherichia virus Min27)
SSDB
Motif
Pfam: RIP
Other DBs
NCBI-GeneID: 6159405
NCBI-ProteinID: YP_001648932
RS: NC_010237
UniProt: B0FEE0
LinkDB
Position
NC_010237:23167..24126
AA seq 319 aa
MKCILFKWVLCLLLGFSSVSYSREFTIDFSTQQSYVSSLNSIRTEISTPLEHISQGTTSV
SVINHTPPGSYFAVDIRGLDVYQARFDHLRLIIEQNNLYVAGFVNTATNTFYRFSDFTHI
SVPGVTTVSMTTDSSYTTLQRVAALERSGMQISRHSLVSSYLALMEFSGNTMTRDASRAV
LRFVTVTAEALRFRQIQREFRQALSETAPVYTMTPGDVDLTLNWGRISNVLPEYRGEDGV
RVGRISFNNISAILGTVAVILNCHHQGARSVRAVNEESQPECQITGDRPVIKINNTLWES
NTAAAFLNRKSQFLYTTGK
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaagtgtatattatttaaatgggtactgtgcctgttactgggtttttcttcggtatcc
tattcccgggagtttacgatagacttttcgacccaacaaagttatgtctcttcgttaaat
agtatacggacagagatatcgacccctcttgaacatatatctcaggggaccacatcggtg
tctgttattaaccacaccccaccgggcagttattttgctgtggatatacgagggcttgat
gtctatcaggcgcgttttgaccatcttcgtctgattattgagcaaaataatttatatgtg
gccgggttcgttaatacggcaacaaatactttctaccgtttttcagattttacacatata
tcagtgcccggtgtgacaacggtttccatgacaacggacagcagttataccactctgcaa
cgtgtcgcagcgctggaacgttccggaatgcaaatcagtcgtcactcactggtttcatca
tatctggcgttaatggagttcagtggtaatacaatgaccagagatgcatccagagcagtt
ctgcgttttgtcactgtcacagcagaagccttacgcttcaggcagatacagagagaattt
cgtcaggcactgtctgaaactgctcctgtgtatacgatgacgccgggagacgtggacctc
actctgaactgggggcgaatcagcaatgtgcttccggagtatcggggagaggatggtgtc
agagtggggagaatatcctttaataatatatcagcgatactggggactgtggccgttata
ctgaattgccatcatcagggggcgcgttctgttcgcgccgtgaatgaagagagtcaacca
gaatgtcagataactggcgacaggcctgttataaaaataaacaatacattatgggaaagt
aatacagctgcagcgtttctgaacagaaagtcacagtttttatatacaacgggtaaataa

DBGET integrated database retrieval system