KEGG   Viruses: 6972909
Entry
6972909           CDS       T40000                                 

Gene name
stx2cB, Stx2-1717_gp42
Definition
(RefSeq) Stx2-converting phage 1717; Shiga toxin Stx2c subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
TAX:563769
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; unclassified Siphoviridae
Organism
vg  Viruses (Stx2-converting phage 1717)
SSDB
Motif
Pfam: SLT_beta DUF2541 Peptidase_C28
Other DBs
NCBI-GeneID: 6972909
NCBI-ProteinID: YP_002274252
RS: NC_011357
UniProt: B6DZW1
LinkDB
Position
NC_011357:25686..25955
AA seq 89 aa
MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNENDTFTVKVAGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagtttctgttaatgcaatggcggcg
gattgcgctaaaggtaaaattgagttttccaagtataatgagaatgatacattcacagta
aaagtggccggaaaagagtactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system