KEGG   Viruses: 6973080
Entry
6973080           CDS       T40000                                 

Gene name
YYZ_gp40
Definition
(RefSeq) Enterobacteria phage YYZ-2008; Shiga toxin Stx1a subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
TAX:564886
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; unclassified Siphoviridae
Organism
vg  Viruses (Enterobacteria phage YYZ-2008)
SSDB
Motif
Pfam: SLT_beta PCC_BT
Other DBs
NCBI-GeneID: 6973080
NCBI-ProteinID: YP_002274176
RS: NC_011356
UniProt: B6DZ87
LinkDB
Position
NC_011356:20853..21122
AA seq 89 aa
MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLL
LSAQITGMTVTIKTNACHNGGGFSEVIFR
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaaaaaaacattattaatagctgcatcgctttcatttttttcagcaagtgcgctggcg
acgcctgattgtgtaactggaaaggtggagtatacaaaatataatgatgacgataccttt
acagttaaagtgggtgataaagaattatttaccaacagatggaatcttcagtctcttctt
ctcagtgcgcaaattacggggatgactgtaaccattaaaactaatgcctgtcataatgga
gggggattcagcgaagttatttttcgttga

DBGET integrated database retrieval system