KEGG   Viruses: 8656648Help
Entry
8656648           CDS       T40000                                 

Gene name
NS1, FLUAVH5N1_s8gp2
Definition
(RefSeq) Influenza A virus (A/goose/Guangdong/1/1996(H5N1)); nonstructural protein 1
  KO
K19396  Influenza A virus non-structural protein 1
Taxonomy
TAX:93838 [GN:T40041]
  Lineage
Viruses; ssRNA viruses; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H5N1 subtype
Taxonomy
Organism
vg  Viruses (Influenza A virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Flu_NS1
Motif
Other DBs
NCBI-GeneID: 8656648
NCBI-ProteinID: YP_308673
RS: NC_007364
UniProt: Q9Q0L6
LinkDB All DBs
Position
NC_007364:15..707
AA seq 230 aa AA seqDB search
MDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGRGSTLGLDLRVATME
GKKIVEDILKSETNENLKIAIASSPAPRYITDMSIEEMSREWYMLMPRQKITGGLMVKMD
QAIMDKRIILKANFSVLFDQLETLVSLRAFTESGAIVAEIFPIPSVPGHFTEDVKNAIGI
LIGGLEWNDNSIRASENIQRFAWGIHDENGGPSLPPKQKRYMAKRVESEV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggattccaacacgataacctcgtttcaggtagattgttatctatggcacataagaaag
ctactcagtatgagagacatgtgtgatgccccctttgatgacaggctccgaagagaccaa
aaggcattaaagggaagaggcagcacacttggactcgatttaagagtggctacaatggag
gggaaaaagatcgttgaggacatcctgaagagtgagacaaatgaaaacctcaaaatagcc
attgcttccagtcctgctcctcggtatatcaccgatatgagcatagaggagatgagccga
gaatggtacatgctgatgcctaggcagaaaataactggaggccttatggtgaaaatggac
caagccataatggataaaagaattatccttaaagcaaatttctcagttctatttgatcaa
ctagagacattagtctctctgagggcattcacagaaagtggtgctattgtggctgaaata
tttcccattccctccgtaccaggacattttacagaggatgtcaaaaatgcaattggaatc
ctcatcggtggacttgaatggaatgataactcaattcgagcgtctgaaaatatacagaga
ttcgcttggggaatccatgatgagaatgggggaccttcactccctccaaaacagaaacgc
tacatggcgaaacgagttgagtcagaagtttga

DBGET integrated database retrieval system