KEGG   Viruses: 911919
Entry
911919            CDS       T40000                                 

Gene name
UL39, GaHV3gp054
Definition
(RefSeq) Gallid alphaherpesvirus 3; ribonucleotide reductase subunit 1
  KO
K19448  Simplexvirus ribonucleoside-diphosphate reductase large subunit [EC:1.17.4.1]
Taxonomy
TAX:35250
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Mardivirus
Organism
vg  Viruses (Gallid alphaherpesvirus 3)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN NRDD FlaA
Other DBs
NCBI-GeneID: 911919
NCBI-ProteinID: NP_066871
RS: NC_002577
UniProt: A0A1P7U1C6
LinkDB
Position
NC_002577:90207..92600
AA seq 797 aa
MQRSDENESLEANRNLDTASRNCTDVQVALIMATKLHRIQQQLASMGYLSGYDSVPDITT
PVKVLRERITHLVNTLKPVCRFDERVYYACGELVHLRIKSQEATFDAWLMSKKLSLKGEI
VDNIQRHRGHVETDMLRFYGVTYPWLKRLGLQSALKYEEYLTELEDGKKESLCQFFVRLA
AAAATEASNKKAFMSALGTEVSTWETAFTAFFFALARQIFVPSTPCMLFLGREGTSTASC
YLMDPRTINTHDTLKAIADDIVPHLLARGGIGISLQHLNQKTGLMPVMKVLDSLVMAANA
GERRPTGVCVYLEPWHADIMSALNMRGMMATEESRRCDNVFIALWTCDLLFKRYERHANG
EKNVTWTLFDSRASILATLHGSEFEKEYNRLEAEGLGVASLPVRDLMFAIIKSAASTGSP
FILFKDACNKHYITDTQGDAIAGSNLCTEIIQKTDGNTNGVCSLVSVNLARCVFDENGEK
KFDFSALRRAVRLATVFVNSIMSSSDVPTAKSRSGKDRHRSMGIGVQGLHTALLSMGLDL
SDERVKPLNKQIFELMLLEAMTVSCEFCEGGLPAFADFSNSYYSRGRLHFDGWANVGLSM
PEEWNALRERIQASGLYNAQFVALMPTAASAQVTEVSESFLPVFSNMFNKVTTAGELLRP
NNQLMGELREIYADNEDRRLKAIAALECANWCVETALGNKPECSQLLKYKTAFEYDQSLL
IDLCADRAPFVDQSQSMTLFVTEAADGTLLASHVMNLLLRAYKAGLKTGMYYCKIRKATN
AGVFSGNGELTCSSCIL
NT seq 2394 nt   +upstreamnt  +downstreamnt
atgcagcgatccgatgaaaacgaatccctcgaagcgaatagaaatttggacaccgcctcg
cgtaactgtactgatgtgcaggtagccttgataatggcaacgaaattgcatcgcatccag
cagcaacttgcgagcatgggatatttatctggctacgattccgtgcccgatattactaca
cccgtgaaagttctgcgcgagcgcattacccatctagtaaatacattgaaacccgtttgc
cgtttcgatgagcgcgtgtactacgcctgcggggagctggtgcatttacggatcaaatca
caggaagctacttttgatgcgtggttgatgtcgaaaaaattaagcctgaaaggcgagatc
gtagataacatacagcgccacagaggtcacgtagagacggatatgctgcgcttttacgga
gtaacctatccctggctgaaacgactgggtttacagtcggcgttgaaatacgaagaatat
ctgactgagttggaagacggcaaaaaagaatctctttgccagttttttgttcggctggcc
gcggcggcagcaaccgaagcgtcaaacaaaaaagctttcatgtcggctttgggtaccgaa
gtgtcgacctgggaaacggctttcacggctttttttttcgctctcgctcgtcagatattt
gtcccatcgactccctgtatgctttttttggggcgcgaaggaacctcaaccgcgagctgt
tatctcatggaccccagaactataaatacacacgatacccttaaagcgatcgccgacgat
atagttccccatctcctagcgagaggagggatagggatatcgttgcagcatttaaaccaa
aaaacaggccttatgcctgtgatgaaagtattggattccttagtgatggccgcgaatgcg
ggggagcgtcgacccacgggggtatgcgtttatctcgaaccgtggcacgcggacatcatg
tctgcattaaatatgcgcggcatgatggcgacggaagagtcccgtaggtgcgataacgta
tttatcgccctttggacttgcgatttactgtttaagcgctacgagagacacgcaaacggg
gagaaaaatgtgacgtggaccttattcgattcccgcgcgtcgatattggccacgcttcac
ggatcggaattcgaaaaggagtataaccgtttagaagcggaaggtttaggcgtagctagc
ctccctgtaagggatttgatgttcgcaataatcaaaagtgcggcgtccaccggtagcccc
tttattctctttaaagacgcgtgcaacaagcactacattacagatactcaaggagacgcc
attgcaggctctaatctgtgtaccgaaatcattcaaaaaaccgacggaaatacaaacggg
gtgtgcagcttagtaagcgtcaacctcgcccgatgtgttttcgacgagaacggagagaaa
aaatttgatttttccgcccttagacgcgccgtgcggctggctacggtgttcgttaactcg
ataatgtctagcagcgatgttccgactgcgaaatctcgttccggtaaagatcgacacaga
tccatgggcataggcgttcaggggcttcatacagctctgttgtcaatgggtctcgatttg
agcgatgaacgcgtcaagcccctcaacaagcagatttttgaattgatgttgttagaggcc
atgacggtcagttgtgaattttgcgaaggcgggttgcccgccttcgccgacttctccaac
agctattactcacgggggcgcctgcattttgatggctgggcaaacgtaggcttaagtatg
cccgaagagtggaatgcgctgcgggagagaatacaggcgtccgggttatacaatgcccag
ttcgtagcgttgatgccgacagccgcatccgcacaagtaaccgaagtgagtgagagtttt
ttgcccgtgttcagcaacatgtttaacaaagtgacgacggcgggggaactactgcggccc
aataatcaattaatgggagagttgagggagatctatgcggataatgaggatcggcgattg
aaagccatagcagcgttggagtgcgcgaactggtgcgtggagaccgctctgggaaataag
cccgaatgctctcaattacttaaatacaaaacggcgttcgagtacgaccaatccctccta
atagatttgtgtgccgatagggcgccttttgtggatcaaagccagtcgatgactctgttt
gtgacggaagcggctgacggaacgctgctggcgtctcacgtcatgaacctactcttacgc
gcctataaagccggcctgaaaacaggaatgtattactgcaagatacgcaaggcgactaat
gccggagtattcagcggtaacggcgaattgacctgctcgtcctgcatactataa

DBGET integrated database retrieval system