KEGG   Viruses: 921116
Entry
921116            CDS       T40000                                 

Gene name
THVgp103
Definition
(RefSeq) Tupaiid betaherpesvirus 1; T80
  KO
K21078  Betaherpesvirinae capsid scaffolding protein [EC:3.4.21.97]
Taxonomy
TAX:10397
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae
Organism
vg  Viruses (Tupaiid betaherpesvirus 1)
SSDB
Motif
Pfam: Peptidase_S21
Other DBs
NCBI-GeneID: 921116
NCBI-ProteinID: NP_116431
RS: NC_002794
UniProt: Q91TL5
LinkDB
Position
NC_002794:127913..130117
AA seq 734 aa
MAPGDGAAAPGDGGPVYVGGFLCLYEESPAESELALPRAVIRARVAAAGTEPLLPLNVNH
EESATVGEVCHLADVDAGLFCFGEIVSPSFLEIMTKSADRSALVRRGPGGGLKPDPVVEY
LSTMYPSLSLSSRALVGECGREPEAARHAADAGADAGADAGADAFFRHVALCGVGRRRGT
LAMYGRDPTWVVDRLASRFGPGEREDVLRGIETRLAARRRAHRPDAFRSDPIGLLANSTD
TAYIRERFPKLEYDKKVLRVGPDTYIKASEEPTDAGSATRREPAAAAGLVCNIKDARDAP
PASDSPASRASGAVAEGDRRPEDRERESAAMAQPHAAAVAAPTAAPGVAPGALTMPGDCV
YLPKDAFLSLVQRSYAPPPPPAVAAAVPGAAYALPGAPGPLTTTPLPMPPDGPPPATAYH
HPPPPSQHSGLPPAPAIPYYYPPAPTFADPGTAYRSPISYENPGYRGREPWGWRSGGQKR
RSQPPSSHGRRDDGEPAFDESGDDWDEEGDAETESRGWRVAKRGRTDGRSDPSARLRGRT
GRRKRPAEEGEEVSFPGDADYGTRKRSDRRMGRERLDDDERESAEYGELRLTLEELRKDL
RLLREQAAAAGPTTTATTAAASVPGSPPSSTLVPEETPPLATIPPPTPPPPATTVKVVDA
TKERRERKERKDLAAPERRLERSSALIETDVVNASCDPLGPTTGGGGAGPSEAGRQLLAM
NRQLFVRALNKIDA
NT seq 2205 nt   +upstreamnt  +downstreamnt
atggcgccgggtgacggcgcggcggcgccgggcgacggcgggccggtctacgtggggggc
tttctctgtctgtacgaggaatcgccggccgagtccgagctggcgttgccgcgagccgtg
atccgggctcgggtggccgccgccgggaccgagcccctgttgccgctcaacgtgaatcac
gaggagtccgcgacggtcggcgaggtctgtcacttggcggatgtggacgccgggctgttc
tgtttcggggaaatcgtctcgcccagttttctcgagatcatgaccaagtccgccgaccgg
tcggctttggtgcggcgcggcccgggcggagggctcaagccggatccggtcgtcgagtac
ctcagcacgatgtatcccagtctctccctgtccagtcgcgcgctggtcggcgagtgcggg
cgggagcccgaagcggcgcgacacgccgccgacgctggcgccgacgctggcgccgacgct
ggcgccgacgcgttctttcgacacgtggcgctgtgcggcgtggggcggcgccggggcacc
ctggcgatgtacgggcgcgacccgacctgggtcgtcgatcgtctggcgagtcgcttcgga
cccggggagcgggaggacgtgctgcgcggaatcgagacgcggttagccgcccggcgccga
gcgcaccgcccggacgcttttcggtccgacccgatcgggctcttggccaacagcacggac
acggcgtatatccgcgagcgcttccccaaactggaatacgataagaaggtcttacgggtc
ggccccgacacgtacatcaaggccagcgaggagcccacggacgccgggtccgcgacgcgg
cgggagccggccgccgccgccggactcgtctgtaatattaaagatgctcgcgacgctccc
ccggcgagcgactcgccggcctcgagggcctcgggggcggtggcggagggggatcggcgg
ccggaggaccgggaacgggagtcggccgcgatggctcagccgcacgccgcggccgtcgcc
gcgccgacggcggcgcccggagtcgcgccgggcgccctgacgatgccgggcgactgcgtg
tatctaccgaaagacgcgttcctctcgctggtccagcggtcgtacgcgccgccgccaccg
ccggcggtggcggcggccgtgccgggcgcggcgtacgctttgcctggggcgccggggccg
ttgaccacgacgccgttaccgatgcccccggacggacctcctcccgccaccgcctatcat
caccctcctccgccttctcagcactcggggctgccgccggcgccggcgataccgtattac
tatccgccggcgccgaccttcgcggacccggggacggcctatcgctcgccgatcagttac
gagaatccgggctatcgtggccgggagccctgggggtggaggagcggcggacagaaacga
cggtcgcaaccgccgtcttcgcacggtcggcgggacgacggggagcccgcgttcgacgag
agcggcgacgactgggacgaagaaggggacgcggagaccgaatcgcgaggctggagagtc
gcgaagcgagggcggacggacgggcgctcggacccctccgctcgtctacggggccggacg
ggtcgccgcaagcgcccggccgaagaaggagaggaggtgagctttcccggggatgcggat
tacgggactcgaaaacggtcggatcgtcgaatgggacgcgagcgtttggacgacgacgag
cgtgagtctgccgagtacggagagctgcggctgaccctggaggagctccgaaaagatctc
cgtcttctacgagaacaggccgccgctgccggcccgacgacgacggcgacgaccgcggcc
gcctcggtgccgggatcaccgcccagttcgacgttggtgccggaggagacgccgccgctc
gcgacgataccgccgccgacgccaccgccgccggcgacgacggtcaaggtcgtcgacgcg
acgaaggagcggagagagcgaaaagaacggaaagatctagcggctccggagagacggctc
gagaggagctcggcgctgatcgaaacggacgtcgtcaacgcctcgtgtgatccgctcggc
cccaccacgggcggcggcggcgcggggccgtcggaggccggacggcaactgctggcgatg
aaccgccagttgttcgtgagagccttgaataaaatcgacgcttga

DBGET integrated database retrieval system