KEGG   Viruses: 921233
Entry
921233            CDS       T40000                                 

Gene name
THVgp150
Definition
(RefSeq) Tupaiid betaherpesvirus 1; T122
  KO
K22775  Cytomegalovirus viral transcription factor IE2
Taxonomy
TAX:10397
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae
Organism
vg  Viruses (Tupaiid betaherpesvirus 1)
SSDB
Motif
Pfam: Herpes_IE2_3 SR-25 DUF4667 HRM CCDC106
Other DBs
NCBI-GeneID: 921233
NCBI-ProteinID: NP_116478
RS: NC_002794
UniProt: Q91TH4
LinkDB
Position
NC_002794:complement(186727..187974)
AA seq 415 aa
MYTDPLPSSSSPLAESRTTPSPSHSPGAYSPAYSGPSSPIPSPSSVNITLGLLCPEEDAA
PSWRGAKTVFPMARPISSATERAAASSVTGDGTASPSPPGPASRPVSHPGKQLRAPSPSS
SSSSSSSSSSSSSSSSSDSSSDEEGEGGTAAPRAKRPKCSPPFEAGRIRMLLKSKTQPFD
KPQGESKRGRVKSGDLTRLFRTTQRSLEYKTLPFKAPPLHEVWEQTVRACRELQVLNKAI
LLSYTRTYDVRSAVEDVRAKLGTTVNLSISAPWTMEHTLPRVHTPQTVERVSRACRDGVK
TAWELQEHHTHQYCPRASDVRTIMIQAATPCEFLTASRLCLELMQKYPKQVAVRTCTIDG
GHNLLPIYEGPSSDYSNCQFDVQTNSCNRLDEINEAVAQAIRDLESGDREQQQQQ
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgtataccgaccccttgccgagctcctcctcccctctggccgagagcaggaccaccccc
tccccctcccactctcccggggcctattcccccgcttactccgggccctcgtcccccatc
ccgtccccgtcctcggtcaacatcacgctgggcctcttgtgtcccgaggaagacgccgca
ccgtcttggcggggcgccaagacggtgttccccatggccaggcccatctctagcgccacc
gagcgggcggcggcctcctcggtgaccggcgacggcaccgcttctccttctcccccgggc
ccggcgtcccgcccggtttcccacccgggcaaacaactgcgggccccgtccccctcgtcc
tcgtcctcgtcctcgtcgtcgtcctcctcatcctcgtcctcctcctcgtccgactccagc
tccgacgaggagggcgaaggcggcaccgccgcgccccgcgccaaacgccccaagtgcagc
ccccccttcgaagccgggcgcatccgcatgctcctgaagtcgaagactcagcccttcgac
aagccccagggggagtccaagagggggcgggtgaaaagcggggacctgacccggctgttc
cggaccacgcaacgctcgctggagtacaagactctgccgttcaaggccccgcccctgcac
gaagtctgggagcagaccgtccgcgcctgccgcgaactgcaagtcttgaacaaagcgatc
ctcctgagctacacccgcacgtacgacgtgcggagcgcggtggaagacgtgcgcgccaag
ctggggaccaccgtgaacctgtcgatctcggccccgtggacgatggagcacaccctgccc
cgggtccacaccccccagaccgtggagcgcgtgtctcgggcgtgtcgcgacggcgtgaag
acggcgtgggagctgcaggaacaccacacgcaccagtactgcccccgcgcgtcggacgtg
aggaccatcatgatccaggcggcgaccccctgcgagttcctcacggccagccgcctctgt
ctggaactgatgcagaagtaccccaagcaggtggccgtgcgcacctgcacgatcgacggc
gggcacaacctcttaccgatctacgaaggtccctcgagcgattacagcaactgtcagttt
gacgtgcagaccaacagctgcaaccggctggacgagatcaacgaggcggtggcgcaggcg
atccgagacttggagagcggcgaccgggagcagcaacagcagcagtga

DBGET integrated database retrieval system