KEGG   Viruses: 929695
Entry
929695            CDS       T40000                                 

Gene name
stxA2e, P27p25
Definition
(RefSeq) Enterobacteria phage phiP27; Shiga toxin Stx2e subunit A
  KO
K11006  shiga toxin subunit A
Taxonomy
TAX:103807
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; unclassified Myoviridae
Organism
vg  Viruses (Enterobacteria phage phiP27)
SSDB
Motif
Pfam: RIP
Other DBs
NCBI-GeneID: 929695
NCBI-ProteinID: NP_543077
RS: NC_003356
UniProt: Q9MBZ8
LinkDB
Position
NC_003356:17502..18461
AA seq 319 aa
MKCILLKWILCLLLGFSSVSYSQEFTIDFSTQQSYVSSLNSIRTAISTPLEHISQGATSV
SVINHTPPGSYISVGIRGLDVYQERFDHLRLIIERNNLYVAGFVNTTTNTFYRFSDFAHI
SLPGVTTISMTTDSSYTTLQRVAALERSGMQISRHSLVSSYLALMEFSGNTMTRDASRAV
LRFVTVTAEALRFRQIQREFRLALSETAPVYTMTPEDVDLTLNWGRISNVLPEYRGEAGV
RVGRISFNNISAILGTVAVILNCHHQGARSVRAVNEESQPECQITGDRPVIKINNKLWES
NTAAAFLNRKSQPLYTTGE
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaagtgtatattgttaaagtggatactgtgcctgttactgggtttttcttcggtatcc
tattcccaggagtttacgatagacttttcgactcaacaaagttatgtatcttcgttaaat
agtatacggacagcgatatcgacccctcttgaacatatatctcagggagctacatcggta
tccgttattaatcatacaccaccaggaagttatatttccgtaggtatacgagggcttgat
gtttatcaggagcgttttgaccatcttcgtctgattattgaacgaaataatttatatgtg
gctggatttgttaatacgacaacaaatactttctacagattttcagattttgcacatata
tcattgcccggtgtgacaactatttccatgacaacggacagcagttataccactctgcaa
cgtgtcgcagcgctggaacgttccggaatgcaaatcagtcgtcactcactggtttcatca
tatctggcgttaatggagttcagtggtaatacaatgaccagagatgcatcaagagcagtt
ctgcgttttgtcactgtcacagcagaagccttacggttcaggcaaatacagagagaattt
cgtctggcactgtctgaaactgctcctgtttatacgatgacgccggaagacgtggacctc
actctgaactgggggagaatcagcaatgtgcttccggagtatcggggagaggctggtgtc
agagtggggagaatatcctttaataatatatcagcgatacttggtactgtggccgttata
ctgaattgccatcatcagggcgcgcgttctgttcgcgccgtgaatgaagagagtcaacca
gaatgtcagataactggcgacaggcccgttataaaaataaacaataaattatgggaaagt
aatacagcagcagcgtttctgaacagaaagtcacagcctttatatacaactggtgaatga

DBGET integrated database retrieval system