KEGG   Viruses: 929727
Entry
929727            CDS       T40000                                 

Gene name
stxB2e, P27p26
Definition
(RefSeq) Enterobacteria phage phiP27; Shiga toxin Stx2e subunit B
  KO
K11007  shiga toxin subunit B
Taxonomy
TAX:103807
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; unclassified Myoviridae
Organism
vg  Viruses (Enterobacteria phage phiP27)
SSDB
Motif
Pfam: SLT_beta Peptidase_C28
Other DBs
NCBI-GeneID: 929727
NCBI-ProteinID: NP_543078
RS: NC_003356
UniProt: Q9MBZ7
LinkDB
Position
NC_003356:18474..18737
AA seq 87 aa
MKKMFIAVLFALVSVNAMAADCAKGKIEFSKYNEDNTFTVKVSGREYWTNRWNLQPLLQS
AQLTGMTVTIISNTCSSGSGFAQVKFN
NT seq 264 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatagcggttttatttgcattggtttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggataatacctttactgtg
aaggtgtcaggaagagaatactggacgaacagatggaatttgcagccattgttacaaagt
gctcagctgacagggatgactgtaacaatcatatctaatacctgcagttcaggctcaggc
tttgcccaggtgaagtttaactga

DBGET integrated database retrieval system