KEGG   Viruses: 935456
Entry
935456            CDS       T40000                                 

Gene name
US6, CCMVgp137
Definition
(RefSeq) Panine betaherpesvirus 2; membrane glycoprotein US6
  KO
K22785  HCMV membrane glycoprotein US6
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB
Motif
Pfam: US6
Other DBs
NCBI-GeneID: 935456
NCBI-ProteinID: NP_612779
RS: NC_003521
UniProt: Q8QRV3
LinkDB
Position
NC_003521:complement(207055..207633)
AA seq 192 aa
MRYLGLLKLLGLALFSVSAGRADPRDAPPEDLLSLFHRRQTCVPKKRIGVSECRNGTEDC
DRTGGEEPEDDAAERLTSRWIQTALESYGNKAREGEEEEYRHPEGLINCRQVSRLLPCNA
SGLRPSHRLLLLMSNCVCEGPAWGVIRFVERHGLIAVSIYLFCMVNAVIFTMVLLCGVRG
EQLERSSRRCGS
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcggtacctaggacttttgaagctgctggggctcgcgctgttctcggtgtcggccggc
cgcgccgacccgagggacgcgccccccgaagacctgctatccctgtttcatcggcggcaa
acctgcgtgccgaagaagaggatcggagtctcggagtgccgtaacggcacggaagactgt
gaccgcacgggaggagaggaaccggaggacgatgccgccgagcggctcacatcccgctgg
attcagacggccctggaatcttatgggaacaaggctcgggagggagaagaggaggaatac
cgacacccggagggactcatcaactgccgacaggtcagccgtctcctgccctgcaacgcc
tccggcctgcggcccagccaccgactgctgttgctcatgagcaactgcgtctgcgaagga
cccgcctggggcgtcattcgcttcgtggaacgccacgggctcatcgccgtcagcatctac
ctgttctgcatggtcaacgcggtgatcttcaccatggtgctgctgtgcggcgtgcgcggc
gagcagctggagcggagttcccgacgttgcggctcctga

DBGET integrated database retrieval system