KEGG   Viruses: 935457
Entry
935457            CDS       T40000                                 

Gene name
UL122, CCMVgp103
Definition
(RefSeq) Panine betaherpesvirus 2; regulatory protein IE2
  KO
K22775  Cytomegalovirus viral transcription factor IE2
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB
Motif
Pfam: Herpes_IE2_3 Herpes_IE1
Other DBs
NCBI-GeneID: 935457
NCBI-ProteinID: NP_612745
RS: NC_003521
UniProt: Q8QRY7
LinkDB
Position
NC_003521:complement(join(172158..173695,175306..175490,175606..175679))
AA seq 598 aa
MESSSGKRKMDSANPDEGPSSKIPRPETPVSKACAFLTSMIQKEVNSQLNLGDPLFPDVS
EDDLKSFEDVTKECDENPGKDILQELGIDILAQAVNQAGIDATTAGVTPTTNTCTTSSAP
STGGVCGAAPPSTPSPPVLLPERSVTPDLVSPRKKPRKTQRPFKVIIKPPVPPTPIMMPM
IKREIKPDPDFTIQYRDTTIEPTSCIVISDSEEEEGEEVPQKQSESQPRQVQSSAASSSS
SSSGSSSSSSRGCSPQVSPATQKAARMNPLLHRQQVQMEVHPPSSSQKDEDSSSSSSSSC
SSASDSESESEETKSAPSCVSLTATGGVVRGAPGGSQNAGPRKKKSKRISELDNERVRNI
MKDRNTPFSTPSAQTKRGRVRTEDVDRMFRNTTRSLEYKNLPFNIPSIHQVLEEAIKSCN
SMQVNNKGIQLIYTRNHEVKSEVDAVRCRLGSMYNLSLSTPFLMEHTVPVTHPPDVCHRT
AEACASGVKAVWDMKETHTHQLCPRSSDYRNMIIHGATPVDFLGALNMCLPLMQKFPKQV
MLRIFSTNQSSFMLPIYESAAKAYAVGQFEEPAETTEDLDTLSMAIEAAIEDLRNKSQ
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggagtcatcatctggaaagagaaagatggactctgccaaccctgatgagggcccctcc
agcaagatcccaaggcccgagacccccgtgtccaaggcatgtgccttcctgacttccatg
atccagaaggaggtcaacagccagctgaacctgggagaccctctgttccccgatgtgtct
gaagatgacctgaagtcctttgaagatgtcaccaaggagtgtgatgagaaccccgggaag
gacattctgcaagaacttggtattgacatcctcgcccaggctgtcaatcaggccggtatc
gacgccactaccgccggtgtcacccccaccaccaatacttgcaccaccagcagcgccccc
tccacgggtggtgtttgcggagccgctcctcccagcactccatctcctcccgtcctcctt
cccgagaggtccgtcactcccgacctcgtcagtcctcgtaagaaaccccgtaagacccag
cggcccttcaaggttattattaaaccgcccgtgcctcccacgcccatcatgatgcccatg
atcaagcgggagatcaagcccgaccccgacttcaccatccaataccgagacacgactatc
gagcccacctcttgtatcgtgatctccgatagcgaggaggaagagggtgaggaagtgcct
cagaagcagtctgagtcacaaccgcggcaggtccagtcttctgctgcttcctcctcttcc
tcttcttcgggctcttcttcctcctcctctcgcggctgctcccctcaagtgagccccgcg
acccagaaggcggcccggatgaaccccctcctacaccgtcagcaggtgcagatggaggtg
caccctccctcctcctcccagaaggacgaggacagctcttcctcgtcttcctcctcctgc
agctcggcctcagactccgagagcgagtccgaggagaccaagtcggcccccagctgcgtg
agcctcaccgccacgggcggcgtggtccgcggcgcccccggtggcagccagaatgccggg
ccccgcaagaagaagagcaagcgcatctccgagctggacaacgaacgggtgaggaacatc
atgaaggaccgcaacaccccgttctccacccccagcgcgcagaccaagcgggggcgcgtg
aggaccgaggacgtggaccgcatgttccgtaacaccactcgctcgctggagtacaagaac
ctgcccttcaacatccccagcatccaccaggtgctggaggaggccatcaagtcgtgcaac
tccatgcaggtgaacaataagggcatccagctcatctacactcgcaaccacgaggtgaag
agcgaggtggacgccgtgagatgccggctgggcagcatgtacaacctgtccctgtccacg
cccttcctgatggaacacacggtgcccgtgacccacccgcccgacgtgtgccacaggacg
gccgaggcctgcgccagcggcgtcaaggctgtgtgggacatgaaggagacccacacccac
cagctgtgcccccgctcctcggactaccgcaatatgatcatacacggtgccacccccgtg
gacttcctgggcgccctgaacatgtgcctgcccctgatgcagaagttcccaaagcaggtg
atgctgcgcattttctccaccaaccagagcagtttcatgctgcccatttacgagtcggcc
gccaaggcttacgccgtggggcagttcgaggagcccgccgagaccaccgaggacttagac
accctgagcatggccatcgaggcggccatcgaggacctgaggaacaagtctcagtaa

DBGET integrated database retrieval system