KEGG   Viruses: 935461
Entry
935461            CDS       T40000                                 

Gene name
UL141, CCMVgp118
Definition
(RefSeq) Panine betaherpesvirus 2; membrane glycoprotein UL141
  KO
K21049  Cytomegalovirus protein UL141
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB
Motif
Pfam: UL141 V-set Ig_3
Other DBs
NCBI-GeneID: 935461
NCBI-ProteinID: NP_612760
RS: NC_003521
UniProt: Q8QRX2
LinkDB
Position
NC_003521:complement(186507..187622)
AA seq 371 aa
MARRQVGKVRRLLPLLTVVGMLLLEPEKSSRAGALLSDAAAPTGLPKETRAENYEIVSPA
PMLVAEGERVTVPCTVMIHQWPLAVIRATFCLSPPTERSVELVFNLSRGGEVVVPLEEKL
TESRLRGGVSYNFTDLHVAHLFSLTFRATASSAGVYECLLRNDSHALVLQRFVVLTHLET
LSWADEPCCTPPLGRHSQDRQIWSPTPWRLKHVDCGWSSQMGFRRNRFYIEPASIGDGTE
INIDAGEGEDEECWGPLCQPEEQPDRCWPVVRQYRLPGGCYRSGDKQAKFVPALPPTEPP
LATPPEIPTGLSPWATRGVASFLGFWGFFSVGFVCYLIYLHCCRRCLGRRGDGYRRLPQY
DEYPGHRRMKT
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcgcgtcggcaggtcggcaaggtgcggaggctgttgccgctgctcaccgtcgtcggg
atgctgctgctcgagcccgaaaagtcctcgcgagccggtgcgctgttgtccgacgcggcc
gctcccaccgggctgccgaaagaaacgcgggccgagaactacgagatcgtgtcgccggca
cccatgctggtggccgaaggggagcgagtcacggtcccgtgcacggtcatgatccaccag
tggcctctggcggtcatcagggctacgttctgtctgtcgcctccaaccgagcgtagcgtc
gagctggtcttcaatctctcgcgcggaggggaggtagtcgtccccctcgaggagaagctg
acggagtcgcgtctccgcggaggcgtcagttacaacttcaccgacctgcacgtggctcat
ctgttctcgctgactttccgcgcgacggcgtcctcggccggcgtgtacgagtgcctgctg
cgcaacgacagtcacgcgctcgtcctgcagcgcttcgtcgtcctcacgcatctggagacg
ctgagctgggccgacgagccgtgctgcacgccgccgctgggccgccattcgcaggaccgt
cagatctggtcgcccacgccgtggcgcctgaaacatgtggactgcggttggtcgtcgcag
atggggttccggcgcaaccggttctacatcgagccggcgtcgataggtgacggaacggag
attaacatcgatgccggcgaaggagaggacgaggagtgctgggggcccctgtgtcaaccg
gaggagcagcccgaccgctgctggccggtggtccggcagtaccgactgccgggcggctgc
taccgttctggagacaagcaggcgaagttcgtgccggccctgcctcccacggagcccccg
ctggcgacaccgcccgagatcccgacggggctctcgccctgggccactcggggcgtggcg
agctttctgggtttctggggttttttcagcgtggggttcgtgtgctacctgatctacctg
cactgctgccgccgctgcttgggccgacggggcgatggttatcgacgcctgccgcagtac
gatgagtatccgggacataggaggatgaagacgtga

DBGET integrated database retrieval system