KEGG   Viruses: 935515
Entry
935515            CDS       T40000                                 

Gene name
UL82, CCMVgp073
Definition
(RefSeq) Panine betaherpesvirus 2; tegument protein pp71
  KO
K22779  Cytomegalovirus tegument protein pp71
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB
Motif
Pfam: Herpes_UL82_83
Other DBs
NCBI-GeneID: 935515
NCBI-ProteinID: NP_612715
RS: NC_003521
UniProt: Q8QS17
LinkDB
Position
NC_003521:complement(118780..120456)
AA seq 558 aa
MSRSPSPGEGPSAAGGPGGAPGDNGSTFGRMHCQVLRLVTNHDSSLEPDRLKILDLRTSV
EVSRTSVLCLFQENKSQHDTVDLTDLNVKGHCAVGERDQLKADLINYSQRRMSPGSSTPI
SVLAFGLPLERVPVSGIHLFQAHPRGDEENRLRTEARVDIRRTAYHWGVRTTVSPRWRRK
VDRSLEAEQIFTTEFIFRAGAIPLRLVDAVELLSCSDRNTYIHKAETDARGQWVNVHLQH
ETLHPPPSVFLHFSLYTHGAEVVLRHNPYPHLTRHGDNGFTLHAPRGFTLSRLHREYIVQ
VQNAFETNNTHDVIFFPADIPGVSMEAGPLPDRVRITIRLTWTGENSVRIEHMQILGTIH
LFKRGVLNLLPGKTEKIKRPQIQLRAGLFPRRAVMRGEVSEFRPQSPGELPLEGEEEEEE
EEERSSTPTPPALSESVFAAFEESSEEEESDTEEGLSRALALTGRRRPRRGADEGEDLML
VIPSWNVFVNIDNLVPLTGSVEQAALKPTSYLRSEMQGDVRTAADFTSNLQPVPVPRPSP
MSLPSTSGTAASRSRPRI
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgtctcgatctccttcgcccggggaagggccctcggcggccggcggtcccgggggagcg
cccggggataacggatccaccttcggccggatgcactgccaggtgttgcgcctggtcacc
aaccacgactcgtcgctggaaccggaccgcctcaaaatcctggacctgcgcacctccgtg
gaggtgagccgcacctcggtgctgtgcctcttccaggagaacaaatcgcagcacgacacg
gtggacctgacggacctgaacgtcaaggggcactgcgcggtgggcgagcgcgaccagctc
aaggccgacctgatcaactacagccagcggcgcatgtcgcccggctcgtcgacgcccatc
tcggtgctggccttcggactgcccctggagcgggtgcccgtcagcggcatccacctgttc
caggcccacccgcggggcgacgaggagaaccgactgcggaccgaggcccgggtggatatc
cgacgcaccgcctaccactggggcgtgcgcaccaccgtgtcgccccgctggcgccggaag
gtggaccgcagcctggaggccgagcagatcttcaccaccgagttcatcttccgggccggg
gccatcccgctgaggctggtggacgccgtggagctgctgtcgtgctcggaccgcaacacc
tacatccacaaagcggagacggacgcccgcggccagtgggtaaacgtccacctgcagcac
gagacgctgcacccgccgcccagcgtgttcctgcacttctcactctatacgcacggcgcc
gaggtggtgctgcggcacaacccgtacccgcacctgacccggcatggcgacaacggcttc
accctgcacgccccgcgcggcttcacactgtcgcgcctccatcgcgagtacatcgtgcag
gtgcagaacgccttcgagaccaacaacacccacgacgtgatcttcttcccggcggacatc
cccggcgtgtccatggaggccggacccctgcccgaccgcgtgcgcatcaccatccgcctc
acctggacgggcgagaactccgtgcgaatcgagcacatgcagatactgggcaccatccac
ctgttcaagcgcggcgtgctcaacctgctgccgggcaagaccgagaagatcaagcggccc
cagatccagctgcgcgccggcctgtttcctcggagggccgtgatgcgcggtgaggtatcc
gagttccgaccccagtcgcccggcgagctgccgttggaaggcgaggaggaagaagaggaa
gaggaggagcgctccagcaccccgacgccgcccgccctatccgaatccgtgttcgccgcc
ttcgaggagagctcagaggaggaggagtcggacaccgaggagggactgtctcgggcgctg
gccctgacgggacgccgccgcccacgccgcggcgccgacgagggcgaggacctcatgctc
gtcatcccctcctggaacgtattcgtgaacatagacaacctggtacccctgacgggcagc
gtggaacaggcagccctgaaacccacctcctacctccgcagcgagatgcagggcgacgtg
cgcacggccgccgacttcaccagcaacctgcagcccgtgccggtgccgcgcccctcgccc
atgagcctgccctccaccagcggtaccgccgcctcccgaagccgaccccgcatctga

DBGET integrated database retrieval system