KEGG   Viruses: 935516Help
Entry
935516            CDS       T40000                                 

Gene name
UL55, CCMVgp057
Definition
(RefSeq) Panine betaherpesvirus 2; envelope glycoprotein B
  KO
K22773  Betaherpesvirinae envelope glycoprotein B
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Taxonomy
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB OrthologParalogGFIT
Motif
Pfam: Glycoprotein_B Glycoprot_B_PH1 Glycoprot_B_PH2 RCR DUF4763 Stevor
Motif
Other DBs
NCBI-GeneID: 935516
NCBI-ProteinID: NP_612699
RS: NC_003521
UniProt: Q8QS33
LinkDB All DBs
Position
NC_003521:complement(80018..82783)
AA seq 921 aa AA seqDB search
MWAKIWCLVVCVSLLRTPSSGGVYGAPSSSSTSGQPPTPSVPGGSSSSGRTTTRTTQQES
TTNGTEYIFNTTLRPDDVIGVNISKYPYRVCSMAQGTDLIRFDRNIHCTSVKPTKEDLDE
GMMVVYKRNIQAHTFKVRVFQKVLTFRRSYAYIYSTYLLGSNTEYVPPPMWEVHFINNNG
QCYNSYSKVMGDTVFVAYHEDSYENKTMKLIPDDYSNTHSTRYVTVKEQYHTRGSTWLYR
ETCSLNCMVTVTTARSKYPYHFFATSTGDVVDISPFYNKTNGKYFGENADKFYLIANYSM
VEDYGQWNSHKKTHKLVAFLERGDSVLSWDVEDEQNTTCQYAYWESSDRTIRAETHDSLH
FTSSKMTATFLSKKTPVNISDPGLACIKDKALTQLETMFNSSYNETYVKHGKVEVFETTG
GLVVFWQGIKQKSLADLEDFAKIQNETLERMRNGTRHKRDTSTSQLSYNSTDVIHNVMYA
QLQFTYDTLRNYINKALAQIAEAWCVDQRRTLEVFKELSKINPSAILSAIYDKPIAARFM
GDVLGLAQCVNINQTSVKVLRDMHTKEKGRCYSRPVVMFTFVNSSHVQYGQLGEDNEILL
GNHRTEECQLPSLKIFIAGNSSYEYVDYMFKRMIDLSTIATVDSMIALDINPLENTDFRA
LELYSQQELRSSNVFDLEDIMREFNSYKQRVKYVEDKVVNPLPPYLKGLDDLMSGLGSAG
KAVGTAIGAVGGAVASVVEGVAAFLKNPFGAFTIILVALAVLVIIYLIYTRQRRMYMQPL
EQLFPYMIQSRSSSTTVTSTSDAPSSSNQAPPSYEDSVYNSGHKSATTSVQPYTTEQAFQ
MLLALQRLDAQHRPQKHKGAPNIVVAPSAPPMSRDNNGASSEDNSSNKKQQPQQKPPKPN
LLDRIRHRKNGYQHLGSEEDV
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccaagatctggtgcctggtagtctgcgttagcttgctgcggacgccctcctcc
ggcggcgtgtatggagctccttcgtcatctagcacgtctggacaaccacccaccccctct
gtgccaggtgggtcttcttcctccggtcgtacgaccacccggacgactcagcaggagagc
actaccaacggtacggaatacatcttcaacaccaccctgcggccggacgatgtcatcggg
gtcaacatcagcaagtatccctatcgtgtctgctccatggcccaggggacggacctcatc
cgcttcgaccggaacatccactgcacctcggtcaagcccaccaaggaggacctggacgaa
ggtatgatggtggtctacaagcgcaacatccaggcgcacactttcaaggtacgtgtcttt
caaaaggtgctcaccttccgccgcagctacgcctacatctacagtacctacctgctgggc
tccaacacggagtacgtgccaccccccatgtgggaggtgcatttcatcaataacaacgga
cagtgctacaattcctacagcaaggtcatgggggacaccgtctttgtggcctatcacgag
gacagctacgagaacaagaccatgaagctcatccccgacgactactccaacacccatagc
acccgctacgtcaccgtcaaggagcagtaccacacccgcggcagcacctggctctaccgc
gagacctgcagccttaactgcatggtgacggtgaccaccgcccgctccaagtacccctat
cacttcttcgccacctccaccggtgacgtggtcgacatctctcccttctacaacaagacc
aacgggaagtacttcggggagaacgctgataagttctacctgatcgccaactacagcatg
gtcgaggactatgggcagtggaattcccacaagaagacccacaagctggtggcctttttg
gagcggggcgactccgtgctctcctgggacgtggaagatgagcagaataccacctgtcag
tacgcctactgggagagttcagaccgcaccatccgcgccgagacccacgactcccttcac
ttcacctcgtccaagatgacggccaccttcctctccaagaagacccctgttaacatctcg
gacccaggtttggcctgtatcaaggataaggccctgactcagctagagactatgttcaat
tcttcctacaacgagacctacgtcaagcacggtaaggtcgaggtcttcgagaccaccggc
ggactggtggtcttctggcaggggatcaagcaaaagtccctggctgatctggaagatttt
gccaagatccagaacgagaccttggagaggatgagaaacggcaccaggcacaaaagagac
accagcaccagtcagctctcttacaacagcacggacgtcatccataacgtcatgtacgct
cagttgcagttcacctacgacacgctgcgcaactacatcaacaaagctttggcccagatc
gccgaggcctggtgcgtggaccaacggcgcaccctagaggtcttcaaggagctcagcaag
atcaacccttcggccatcctctcggccatctacgacaagcccatcgccgcgcgcttcatg
ggcgacgtgctggggttggcgcagtgcgtcaacatcaaccagaccagcgtcaaggtgctg
cgggacatgcacaccaaggagaagggccgctgctactcgcgccccgtcgtcatgttcacc
ttcgtcaacagctctcacgtgcagtacgggcagctcggtgaggacaacgagatcctgttg
ggcaaccaccgcaccgaggagtgccagctacccagcctcaagatcttcatcgccggcaac
tcgtcctacgagtacgtggactacatgttcaagcgcatgatcgacctcagcactatcgcc
acggtcgacagcatgatcgcgctggacatcaatccgctggagaacacggacttcagggcg
ctggagctctactcgcagcaggagttgcgttccagcaacgtcttcgatctcgaggacatc
atgcgcgagttcaactcctacaagcagcgtgtcaagtacgtggaggacaaggtggtcaac
ccgctgccgccctacctcaagggactcgacgacctcatgagcggcctgggctccgccggc
aaggcggtgggcacggccatcggagccgtgggcggcgcggtggcctccgtcgtcgagggc
gtcgccgccttcctcaagaaccccttcggcgccttcaccatcatcctcgtcgccttggcc
gtactggttatcatttatttgatctacacgcgccaacgtcgcatgtacatgcagccgctg
gagcagctcttcccctacatgatccagtcgcgcagctccagcaccaccgtcaccagcacg
tcggacgcgccgtcgtcttcgaaccaagctccgccttcctacgaagacagtgtttataat
tctggccataagtctgcgaccacaagcgtgcagccctacaccacagaacaagcgtttcag
atgctcctggccctccagcggctggacgcgcagcaccggccgcaaaaacacaagggcgct
cccaacatcgtggtcgcgccgtcggcacccccgatgagcagagacaacaacggtgcttcc
tccgaggacaacagcagcaacaagaaacagcagccgcagcagaagccgcccaagcccaat
ttgctcgacaggatccggcatcggaaaaacggttaccaacacctaggttccgaggaggac
gtgtga

DBGET integrated database retrieval system