KEGG   Viruses: 935518
Entry
935518            CDS       T40000                                 

Gene name
UL83, CCMVgp074
Definition
(RefSeq) Panine betaherpesvirus 2; tegument protein pp65
  KO
K21045  Cytomegalovirus tegument protein UL83
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB
Motif
Pfam: Herpes_UL82_83
Other DBs
NCBI-GeneID: 935518
NCBI-ProteinID: NP_612716
RS: NC_003521
UniProt: Q8QS16
LinkDB
Position
NC_003521:complement(120673..122340)
AA seq 555 aa
MESRGRRQPEMINVLGPISGHVLKAVFSRGETPLQPHETKSLQTGIDVKVSQHSLILISQ
YTPESTPCHRGDNHLMVQHTYHTGEEVQNVTVNVHNPTGRAICPSQEPMSLYVYAMPLKM
VNVPDINVHHYPTTAERKYRHLPVADTIIHQSGKQVWQARLTVSNLSWARQQNQWKEPDV
YYTTSFIFNTKDVALRQVVSASQLVCSLENTRVVKMQVVAEHYMKVYLESFHEDVPACKL
FLHLSLGSDEEEDLTMTRNPQPFMRKHQRNGFTIMAPKSLVIKPGKTAHVMLDVAFTSHE
HFGLICPKVIPGLSISSNLLMSGQHIFLELRALRETVEIRQYDALAALFFFDRDMLMLRG
PQYSEHPTFTDQFRVCGKLEYQHTWDRRSGDEVGAAEEVWSSGSDSDEDELADRKPPRPL
PLAGAAAAGSRKRKQPPPTTCTGVMTRGRLKAESSMAPEEDTDEDSDIDSSNPAVFTWPQ
WQAGIQARHLVPLVATVQGHNLKYQEFFWDADDVYRIFHDLEGVWVPCPLPKRRRYRQEP
AAAPCIASTPKKHRG
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggagtcgcgagggcgtcgccagcccgaaatgataaacgtcctgggccccatctcgggg
cacgtgctgaaagccgtgttcagccgcggcgagacgccgctgcagccgcacgagaccaag
tcgctgcagacgggcatcgacgtgaaggtcagccagcactcactgatcctgatctcgcag
tacacgcccgagtcgaccccctgccaccggggcgacaaccacctgatggtgcagcacacc
tatcacacgggcgaggaggtgcagaacgtgacggtgaacgtgcacaaccccacgggccgg
gccatctgccccagccaggagcccatgtcgctgtacgtgtacgccatgccgctcaagatg
gtgaacgtgcccgacatcaacgtgcaccactaccccaccacggccgagcgcaagtaccgc
cacctgcccgtggccgacaccatcatccaccagtcgggcaagcaggtgtggcaggcgcgc
ctgaccgtgtctaacctatcgtgggcgcggcagcagaaccagtggaaggagcccgacgtg
tactacaccacgtcgttcatcttcaacaccaaggacgtggcgctgcgccaggtggtgagc
gccagccagctggtgtgctcgctggagaacacgcgcgtggtcaagatgcaggtggtggcc
gagcactacatgaaggtctacctggagtccttccacgaggacgtgccggcctgcaagctc
tttctgcacctgtcgctgggctccgacgaggaggaggacctaaccatgacgcgcaacccg
cagcccttcatgcgcaagcaccagcgcaacggcttcaccatcatggcccccaagagcctg
gtcatcaagccgggcaagacggcgcacgtcatgctggacgtggccttcacctcccacgaa
cacttcggcctcatctgccccaaggtcatcccgggcctgagcatctcgagcaacctgctg
atgagcggacagcacatcttcctggagctgcgcgccctgcgcgagaccgtggagatacgc
cagtacgacgcgctggccgccctcttcttcttcgaccgcgacatgctcatgctgcgcggc
ccccagtacagcgaacaccccaccttcaccgaccagttccgcgtatgcggcaagctggag
taccagcacacctgggaccggcgcagcggcgacgaggtcggcgccgccgaggaggtctgg
agcagcggctccgactccgacgaggacgagctggcggaccgcaaaccgccccgccccctg
cccctcgccggagccgccgccgcgggcagccgcaaacgcaagcagccgcccccgaccacc
tgcacgggcgtgatgacgcgcggccgcctcaaggccgagtccagcatggcacccgaggag
gataccgacgaggactcggacatcgacagcagcaacccggccgtgttcacctggccccag
tggcaggccggcatccaggcgcgccacctggtgcccctggtggccacggtccagggccac
aacctcaagtaccaggagttcttctgggacgccgacgatgtctaccgcatcttccacgat
ctggagggcgtgtgggtgccctgcccgctgccaaaacgcagacgctaccggcaggagccg
gcggccgcgccgtgcatcgcctcgacacccaaaaagcaccggggttga

DBGET integrated database retrieval system