KEGG   Viruses: 935546
Entry
935546            CDS       T40000                                 

Gene name
UL33, CCMVgp035
Definition
(RefSeq) Panine betaherpesvirus 2; envelope glycoprotein UL33
  KO
K22782  Cytomegalovirus G-protein coupled receptor UL33
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 935546
NCBI-ProteinID: NP_612677
RS: NC_003521
UniProt: Q8QS55
LinkDB
Position
NC_003521:join(40885..40911,41028..42299)
AA seq 432 aa
MDTLLHNVTNRSGGIPHVRDACNQTETLQAIRTTEAFLNLLIILVGGPLNAVVLVTQLLS
NHVHGYSTPTIYMTNLYSTNFLTLSILPFIVLSNQHLLGTNVASCKFLSVIYYSSCTVGF
ATVALIAADRYRVIHRRTYARQSYRSTYVILLITWLMGLIFSTPAAVYTTVVAHDDKNDT
MNASDTSNGSDTNNTNASYHTCVMYFVADEVYTVLMSWKVLLTVVWGVAPVVMMTWFYTF
FYYTVRRTAQKKKSRTLTFVSVLLLSFVILQTPYVSIMIFNSYATGKWSLECQHQTLRLT
VSTLSRLVPNLHCLINPILYALLGNDFLTRLRQCIRGQLFDRRAFLRSQQQHGGTTDAAG
TTQLLPTSPTSGATSEHGKTSSGTKPARVKRGQTFNVPGDTPKSRPKTTCRQHGVSLGQR
LSQSHHNLSLGV
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggacaccttgctgcacaacgtcacgaatcgcagcgggggcatcccccacgtcagggat
gcctgcaaccagacggagacgctgcaggccatccgtaccaccgaagccttcctcaacctg
ctcatcatcctggtgggcggaccgctcaacgcggtggtgctggtcacccagttgctgtcc
aaccacgtgcacggctactcgacgcccaccatctacatgaccaacctctactccaccaac
ttcctcacgctctcgatcctgcccttcatcgtgctcagcaaccagcacctgctggggacg
aacgtggcctcgtgcaaattcctctcggtcatctactactccagctgtacggtgggcttc
gccacagtcgcgctcatcgccgccgatcgctatcgcgtcatccaccgtcgcacctacgcg
cgccagtcgtaccgctccacctatgtgattctgctgatcacctggctgatggggctcatc
ttctcgacccccgccgccgtctacaccacggtggtggcccacgacgataaaaacgatacc
atgaacgccagcgacaccagtaacggcagcgacaccaataacaccaacgcttcctatcac
acctgcgtcatgtacttcgtagccgacgaggtatacacggtgctcatgtcctggaaagtg
ttgctgaccgtggtctggggcgtggcgcccgtggtcatgatgacctggttctacaccttc
ttctactacacggtacgacgtacggcccagaagaaaaagagccgcaccctgaccttcgtc
agcgtcctgctgctctccttcgtcatcctgcagacgccctacgtgtccatcatgatcttc
aatagctacgccaccgggaagtggtctctggagtgccaacatcagacgctgaggctgacg
gtcagcacgctctcgcgcctggtgcccaacctccactgcctcatcaaccccatcctctac
gccctgctgggcaacgactttctcacgcggctgcgacagtgcatccgggggcagctgttc
gaccgccgcgccttcttaaggtcgcagcagcaacacggcggcacgacagacgccgccggc
accacgcagctgctacccacctcgcccacgagcggcgcgaccagcgagcacggcaagacc
tcgtctggcaccaagcccgcgcgcgtcaaacgcggtcagactttcaacgtgccgggagac
acgccgaaatcgcgtccgaaaaccacgtgcagacagcacggcgtttccctgggccagcgg
ctgtcgcaatcgcaccacaacctcagcctcggcgtctag

DBGET integrated database retrieval system