KEGG   Viruses: 935552
Entry
935552            CDS       T40000                                 

Gene name
UL36, CCMVgp038
Definition
(RefSeq) Panine betaherpesvirus 2; tegument protein vICA
  KO
K22788  Cytomegalovirus viral inhibitor of caspase-8-induced apoptosis
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB
Motif
Pfam: US22 DUF1314 AdoMet_dc
Other DBs
NCBI-GeneID: 935552
NCBI-ProteinID: NP_612680
RS: NC_003521
UniProt: Q8QS52
LinkDB
Position
NC_003521:complement(join(46071..47305,47402..47603))
AA seq 478 aa
MDDLRDTLLSYGCIAVRAEDFNSLNEFLDQECGARLHVPWPERCYIQLRSRSALGPFVGK
MGTVCSQGAYVCCQEYMHPIGFLEGPGFMRYQIIVLVGKRGGVYCYDDLHDCVYELAATM
KEFLRVGFRNCDVFYTMRDYQRPMVEYDDYWNSIMLYRSDVESMSAEIARRGYRSYVIDD
PFDECPDTHFAFWTHDGEVMKFKENSFSVVTGGGVIQTMELMIHTVPRISCYHQLLGALG
HEVIERREFIVRQYVLIDNFGTVYGYDPAADAVYRLAEDVVMFTCVMGKKGYRNHRFSTR
REALVRLEKTPVCQHPKKTPDPMAMFEDDDEADQPPQPRRIPSHEEAEGRICDAILESML
ASAKMVLSDSHIATHMWPQELKALADNSSVMHLCATATEGDVEAVRQKILGKVGTLNHFE
LSFRFQDDEPETYMGFLWDMPPCERCVRRRRYKVCDAGRRDLIPPGANVMAPLTPPHV
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggacgacctccgggacacgctgctcagctacggctgcatcgcggtccgggccgaggac
ttcaacagcctcaacgagttcctcgaccaggagtgcggcgcccggctgcatgtgccctgg
cccgagcgatgctacatccagctccgctcgcgcagcgccctgggacccttcgtcggcaag
atgggtaccgtctgctctcaaggtgcctacgtctgctgccaggagtacatgcaccccatc
ggctttctcgaagggccgggcttcatgcgctatcagatcatcgtgctcgtcggcaagcgc
ggcggcgtctattgctacgatgacctccacgactgcgtctacgagctggcggccaccatg
aaggagttcctgcgcgtgggctttcgtaactgcgacgtcttctacaccatgcgcgactac
cagcgccccatggtggagtacgatgattactggaactccatcatgctgtaccgcagcgac
gtcgagagcatgtcggccgagatcgccaggaggggataccgttcctacgtcatcgacgac
cccttcgacgagtgccccgacacccacttcgccttctggacccacgacggcgaggtcatg
aagttcaaggagaactccttcagcgtcgtcaccggcggcggcgtcatccagaccatggaa
ctcatgatccacaccgtgccccgtatcagctgctaccaccagctgctgggggccctgggg
cacgaggtcatcgaacgcagggagttcatcgtgcggcagtacgtgctcatcgacaacttc
ggaaccgtttacggctacgatcccgccgccgacgccgtctaccgcctggctgaggacgtc
gtcatgttcacctgcgtcatgggcaagaagggctaccgcaaccaccgcttcagcacccgg
cgcgaggccctggtgcgcctggagaagacgcccgtgtgccagcaccccaagaagaccccc
gaccccatggccatgttcgaggacgacgacgaggccgaccagcccccgcagccccgccgg
ataccctcgcacgaggaggccgagggacgcatctgcgacgccatcctcgagagcatgctg
gcctccgccaagatggtcctcagcgactcgcacatcgccacccacatgtggccccaggaa
ctcaaggccttggcggacaacagctccgtcatgcacctctgcgctaccgccaccgagggc
gacgtcgaggccgtgcgacagaaaatcctcggcaaggtggggaccctcaaccactttgag
ctgtccttccgcttccaggacgacgagcccgagacctacatgggcttcctctgggacatg
cctccctgcgaacgctgcgtccggaggcggcgctacaaggtctgcgacgccgggcgtcgc
gacctcatcccgcccggtgccaacgtcatggcgcccctcactcctccccacgtctga

DBGET integrated database retrieval system