KEGG   Viruses: 935569
Entry
935569            CDS       T40000                                 

Gene name
UL22A, CCMVgp024
Definition
(RefSeq) Panine betaherpesvirus 2; glycoprotein UL22A
  KO
K22784  HCMV glycoprotein UL22A
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB
Motif
Pfam: Cytomega_UL20A
Other DBs
NCBI-GeneID: 935569
NCBI-ProteinID: NP_612666
RS: NC_003521
UniProt: Q8QS66
LinkDB
Position
NC_003521:join(24817..24899,24977..25208)
AA seq 104 aa
MSRRVLLLGLLAVSLCVALAAPQKRKRSVENEEPAVTKNGDGITLQGELKETSDGEYPDD
NEEDYDVLIEGTMPPEPVEETNNESPQDSEKEDSSEKFEEVKTE
NT seq 315 nt   +upstreamnt  +downstreamnt
atgagccgaagagtgttgcttttaggccttttggccgtcagtctctgcgtggcgctggcc
gcacctcagaaaaggaagcgcagcgtggagaacgaagaacctgccgtcactaagaacggt
gatggcataaccctccaaggtgagctcaaagaaactagcgatggagaatatcctgacgac
aacgaagaagattatgatgtgctgattgaaggcacgatgcccccagagcccgtagaggag
acaaataatgagagcccacaagactccgaaaaggaagacagcagcgagaagttcgaggag
gtcaagacagaataa

DBGET integrated database retrieval system