KEGG   Viruses: 935573
Entry
935573            CDS       T40000                                 

Gene name
UL38, CCMVgp040
Definition
(RefSeq) Panine betaherpesvirus 2; protein UL38
  KO
K22776  Cytomegalovirus apoptosis inhibitor UL38
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB
Motif
Pfam: US22
Other DBs
NCBI-GeneID: 935573
NCBI-ProteinID: NP_612682
RS: NC_003521
UniProt: Q8QS50
LinkDB
Position
NC_003521:complement(48924..49967)
AA seq 347 aa
MAAVATTHATTAIMSMLDEAERQQAQVDVGSLIQASTLGKVALRCLVKKFMKRGVRLPHD
SGLYVCICDPTYEFLTMNLAKINWLERHCPPLDQELVMFGVIESWEEAAPRPTRQVVLFM
TPKWDVFAYESGLLFYLAPSMSQFWHGVIVFEYWNALFPVEVRNHIRQYAQSMDDLLMIY
HQLDYEKQVLEARRDKNAVGPRTFAKSVNCYVRAILEAERRIREGKMPVAFVDRDSLRAN
SLIVTDQPQQQPRQSQQSPQQRRRGHHAHFVDIAPRPTVHRVLSAPPNMLSSANGVTVLP
PTTPCEMDESSCSSTSSSTCTASPSPPLIVGAEETVYTSDDIQMVVV
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggctgccgtcgccaccacgcacgccacgaccgccatcatgagcatgctggacgaggcc
gagcggcagcaggcgcaggtggacgtgggcagcctcatccaggcctctacgttgggcaag
gtggcgctccgatgcttagttaagaagttcatgaagcggggcgtacgactgccgcacgac
tcggggctctacgtgtgtatctgcgacccgacctacgagttcctgactatgaacctggcc
aagatcaactggctggagcgccactgccccccgctggaccaggagctcgtcatgttcggg
gtaatcgagtcttgggaggaggcggcgccgcggcccacgcggcaggtggtgctcttcatg
acgcccaagtgggacgtgttcgcctacgagtcgggtctgctcttctacctggcgcccagt
atgtcgcagttctggcacggcgtcatcgtctttgagtactggaacgccctgtttccagtg
gaggtgcgtaaccacatacggcagtacgcgcagagcatggacgatctgctgatgatctac
caccagctggactatgagaaacaagtgttggaggcgcgcagggacaagaacgcggtaggt
ccgcggaccttcgccaagtcggtcaactgctacgtgcgggccatcctagaggccgagcgc
aggatccgagagggtaagatgcccgtcgccttcgtggaccgcgactcgctgcgggccaat
tcgctaatcgtcacggatcagccccagcagcagccgcgacaatcgcaacagtccccgcag
cagcggcgccgcggtcaccacgcgcactttgtggatatcgccccccgtccgacggtccac
cgggtcctgtccgcacctcccaacatgctgtcgtccgcaaacggcgtgactgtactgccc
cctacgacgccctgcgagatggacgagtcctcgtgttcgtccacctcttcctccacctgc
accgcttctccctccccgccgctgatagtcggcgccgaagagacggtgtacaccagcgac
gacatacagatggtcgtcgtctag

DBGET integrated database retrieval system