KEGG   Viruses: 935577Help
Entry
935577            CDS       T40000                                 

Gene name
UL37, CCMVgp039
Definition
(RefSeq) Panine betaherpesvirus 2; envelope glycoprotein UL37
  KO
K22789  UL37 HCMV immediate early glycoprotein
Taxonomy
TAX:188763
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Taxonomy
Organism
vg  Viruses (Panine betaherpesvirus 2)
SSDB OrthologParalogGFIT
Motif
Pfam: Herpes_UL37_2
Motif
Other DBs
NCBI-GeneID: 935577
NCBI-ProteinID: NP_612681
RS: NC_003521
UniProt: Q8QS51
LinkDB All DBs
Position
NC_003521:complement(join(47771..48709,48805..48847,50046..50491))
AA seq 475 aa AA seqDB search
MSAMSLPYVHLVGGVGLLTFWYLSYRWIQRKRAEDPLPPWLRSEVRRQQRRTRLQRQYGV
IEGEEWPRDLTFALFGRTGQEAEENNNDYSCPDYYAGERRREEEIETPDPEVNPLDAEGL
TGLAREAYDALKKALLRYRSRRQARCETHVGVFYRVAEKRGSQVFITLLALLSACVLTVH
GVTAGCTYSAPVNQTDRNGGFQNCKMNCTYNGTVIYCGPCLGAKKALQLNMTFPRKGNRH
WHARMLNFGLRFHLEGLFPSWVLNQSDLKSNVSQVDGAIFCNTSLIDRRNITTGLLTLNL
TTLNIGYVLRAASNVDVTRRHVYWNVTRNDTDNATDVVKTVLSRHVESNYIFLQDVCPRL
LRRFQRLNVSITNVTVNGGSNNVTAVWNDTESWGMWSKLSVMWKNRRVEFLRSQSRALGH
WAMISMFSATAGTLVILSLFCMVSFWRRRDLIEDFRYTRQDDDHFFIDSGVDNAV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgatgtctctgccctacgtccacctcgtcggtggtgtgggcctgctaaccttc
tggtacctgagctaccgttggatccagcgcaaacgggccgaggacccgctgcctccctgg
ctgaggagcgaggtgcggcggcagcagcggcggacccggctgcagcggcagtacggcgtg
atcgagggcgaggagtggccccgcgacctgaccttcgcgctcttcgggcggaccggacag
gaggcggaggagaacaacaacgactactcctgccccgattactacgccggggagaggaga
cgggaggaagaaatcgagacgccggaccccgaagtcaaccctctggacgccgaaggtctc
acgggactcgctcgggaggcctacgacgccctcaaaaaggccctgctgcgctacaggagc
cgacgacaggcgcggtgcgagacacacgtcggtgtcttttatcgcgtggccgagaaacgc
gggtctcaggttttcatcacgctgctcgcgctgctatccgcgtgcgtgctgacggtgcac
ggagtgacagcgggttgcacttacagcgcacctgtcaatcaaactgaccgcaacggtggt
ttccaaaactgcaaaatgaattgcacgtacaacggaacggtgatctattgtggcccctgt
ctaggagccaaaaaggcgctgcagttgaacatgacatttccacgtaaggggaatcgacat
tggcacgctagaatgctcaacttcggactgcgttttcatctggagggactctttcccagc
tgggtcctgaatcaaagcgacctaaagagcaacgtatcgcaggtcgacggtgcgattttt
tgcaacacgagtttgattgacaggcgaaacattaccacgggactgctgacgttgaatttg
acgaccttgaatatcggttacgttttgcgagccgccagcaatgtggacgtgactcgaagg
cacgtgtactggaacgtgactcgtaacgacactgacaacgcaaccgacgtcgttaagacg
gtgctttcccggcacgtcgaaagcaattacatctttctgcaagacgtgtgtccccgtcta
ttgcgtcgtttccaacgtttgaacgtcagcataaccaacgtgacggtgaacggcggttcc
aacaacgtcacggcggtttggaacgacacggagtcatggggcatgtggagcaagctgtcc
gtcatgtggaaaaaccgccgtgtggagtttctgcgttcccagagccgcgccctgggacac
tgggccatgatcagcatgttctcggccacggcgggcacgctcgtcatactcagcctcttc
tgcatggtctctttctggcgtcgacgcgatttgattgaagatttcagatacacgcgtcag
gacgacgaccatttcttcatcgacagcggcgtcgacaatgccgtctga

DBGET integrated database retrieval system