KEGG   Viruses: 940267Help
Entry
940267            CDS       T40000                                 

Gene name
R55, RcVgp047
Definition
(RefSeq) Rat cytomegalovirus Maastricht; pR55
  KO
K22773  Betaherpesvirinae envelope glycoprotein B
Taxonomy
TAX:79700
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Muromegalovirus; Murid betaherpesvirus 2
Taxonomy
Organism
vg  Viruses (Murid betaherpesvirus 2)
SSDB OrthologParalogGFIT
Motif
Pfam: Glycoprotein_B Glycoprot_B_PH1 Glycoprot_B_PH2 TraK Sharpin_PH LRR_5 Stevor GPDPase_memb
Motif
Other DBs
NCBI-GeneID: 940267
NCBI-ProteinID: NP_064161
RS: NC_002512
UniProt: Q85427
LinkDB All DBs
Position
NC_002512:complement(65221..67965)
AA seq 914 aa AA seqDB search
MRTAWPTARWCPILCACILSLPCFVPVGVTAEASSPTTPAPETTPAREAGTPTAKAAASV
GHTHHHHHNGHHSTVEPASGGPWTTVSPYYDDSQDIPSVSTGKYPYRICMALSTDLVRFG
KTIECPAPSPKTPTEEGIMLVYKQDIVAYTFKVITYYKNLQFQRSYAYIWDDYLLGTTVN
RLAMPCGEIDQINRNNSCYSTAQRVMGDVYIAYHRDEEENVTMPLIPDDYVSSSSSRFVS
TKDAYHRRRKVWMYTESCTINCVVTVTKARSNRPYSFFVLSSGEVVETSPFFNGTNDEPF
EEDTANFRVEANYEMVDRFGDWNVSTHRVHRMAFLERPEVTIAWEIQNKSEALCEWKRWQ
VVVKRAIRTAQNSSYHFVSRSLTATFVTGKHQHNINQTKYVNCILNGTTEELDRVFEEEY
NETHVKDGNVEVYQTSGGLLVFWQKIKPKRLHELGEAIWNITGENVTESEGVNNTSRSRR
RRDVSSVDDIKMDITYTQLQFTYDILRDYINGALQNILEAWCLDQKRQAEMLRELSKINP
SNILSSIYGRPVTAKLAGDVLALSECVPVDQDSVKILKDMRIFVDNKVVNCYARPHVLFK
FVNSSKIESGQLGEHNEILLGNHRTERCETPSRKIFITDEVGYEFRDYVFKNVTNLKDIE
LIDTMIGVSLEPLENTDFQILELYSRGEIRASNVFNLEEIMREYNAQKQSVRFLFTQIIE
DTPPYLRGLDDFMQGLGAAGKGIGMVFGAVAGAVGSIASGFVSFLTNPFGTVTIIIIVIA
IVLVIYIIFRRQQQAVMRPVEYFFPHAMQVAGKPLGALGGGDDRPPSYEDSTSQGKRGNV
TKGGDDAGSGHKKGSGKAYSGEDAAAMLRALQDLEESGRQAAIGVAKKVGRNILDRLRGN
SGYQSLPDSDVEDR
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgcggaccgcctggccgacggcgaggtggtgcccgattctatgcgcgtgcatcctgagc
ctgccgtgtttcgtcccggtgggggtgaccgctgaggccagctcaccgacgaccccggcg
ccggagacgaccccggctcgcgaggccggcacgccgaccgcgaaagcggccgcgtccgtc
ggtcacacacatcaccatcaccacaacgggcaccactcgacggtcgagcccgcgtccggg
ggcccgtggacgaccgtgtcgccgtactatgacgactcgcaggacatcccctccgtctcg
acgggcaagtatccgtatcggatctgcatggcgctgtccaccgacctcgtccgtttcggg
aagaccatcgagtgtcccgctcccagccccaagacgccgaccgaggaggggatcatgctc
gtgtacaagcaggacatcgtggcgtacaccttcaaggtgatcacgtactacaagaacctg
cagtttcagaggagctacgcgtacatctgggacgattacctactggggaccaccgtgaac
cgactggctatgccgtgtggggagatcgatcagatcaatcggaacaacagctgctactcg
accgcccagcgcgtcatgggcgacgtgtacatcgcgtaccatcgggatgaggaggagaac
gtcaccatgcccctgatcccggacgactatgtaagcagcagcagctcccgcttcgtctcc
accaaagatgcgtatcatcgacgccgtaaggtctggatgtacaccgagtcgtgtaccatc
aattgcgtcgttactgtcaccaaggcgcggtccaaccggccgtacagtttcttcgtactc
agttctggggaggttgttgagacgtctccttttttcaacggaactaacgatgagcccttc
gaggaggacaccgccaacttccgcgttgaggcgaattatgagatggttgatcgttttgga
gattggaatgtcagcactcatcgtgtacatcggatggcgttcctcgagcggcccgaggtc
accatcgcctgggagatccagaacaagagcgaagccctgtgcgagtggaaacggtggcag
gtcgtcgtcaagcgcgccatccggaccgcccagaacagctcctatcacttcgtctcccgt
agcctcaccgccaccttcgtgacgggcaaacatcaacacaatatcaatcagaccaagtac
gtcaactgtatcctgaacggaaccacggaggagctggatcgcgtgttcgaagaggagtac
aacgagacgcacgtgaaggatggcaacgtcgaggtctaccagaccagcggcggtctcctc
gtattctggcagaagatcaaaccgaaacggctgcacgaactcggggaggccatctggaac
atcacgggcgaaaacgtcacggagagcgagggtgtcaacaatacctcacgtagccggcgg
aggagagacgtgtcgtcggtggacgatatcaagatggacatcacgtacacgcagctccag
ttcacctacgacatcctccgcgactacatcaacggtgctctgcagaacatcctcgaggcc
tggtgtctcgatcagaagcgccaggccgagatgctgcgcgagctgagtaagatcaacccg
tccaatatcctgtcgtccatctacgggcggcccgtcaccgccaagctggccggggacgtc
ctcgccctgtccgaatgcgtgccggtcgaccaggacagcgtgaagatcctgaaagacatg
cgtatcttcgtggataacaaggtcgtgaactgttacgcgcggccccacgtcctcttcaag
ttcgtcaacagctccaagatcgagtctgggcagctcggcgagcacaacgagatcctgctc
gggaaccaccggacggagcgctgcgagacccccagccgcaagatcttcatcaccgacgag
gtcgggtacgagtttcgtgactacgtgttcaagaacgtcaccaacctgaaggacatcgag
ctcatcgacaccatgatcggcgtgtcgctcgagcccctggagaacaccgactttcagatc
ctggagctgtactctcgcggcgagatccgggcctccaacgtgttcaacctcgaggagatc
atgcgcgagtacaacgcccagaagcagtccgtccgcttcctcttcacccagatcatcgag
gacaccccgccctatctccggggcctcgacgacttcatgcagggcctcggggccgccggg
aagggcatcggcatggtgttcggcgccgtggcgggggccgtcgggtcgatcgcctcgggc
ttcgtctccttcctcaccaatcccttcgggaccgtgaccatcatcatcatcgtcatcgcc
atcgtgctggtcatctacatcatcttccgccgccagcagcaggccgtcatgcgtcccgtc
gagtacttcttcccgcacgccatgcaggtcgccgggaagccgctcggcgccctcggcggg
ggcgacgaccgcccgccgagctacgaggactccacgtcccaggggaagcgcggtaacgtg
accaagggcggcgatgacgcgggaagcggacataaaaagggtagcggcaaggcgtactcc
ggggaggacgcggcggcgatgctcagggcgttgcaggatctcgaggagtccggacggcag
gcggcgatcggggtggctaagaaagtgggtcggaatatattagataggttgcgggggaat
agtggctatcagagcctacccgactccgacgtcgaggaccggtag

DBGET integrated database retrieval system