KEGG   Viruses: 956108
Entry
956108            CDS       T40000                                 

Gene name
gag, Siv2gp1
Definition
(RefSeq) Simian immunodeficiency virus SIV-mnd 2; gag protein
  KO
K22951  HIV-1 gag polyprotein
Taxonomy
TAX:159122
  Lineage
Viruses; ssRNA-RT viruses; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus; Puma lentivirus; Simian immunodeficiency virus - mnd
Organism
vg  Viruses (Simian immunodeficiency virus)
SSDB
Motif
Pfam: Gag_p24 Gag_p17 zf-CCHC
Other DBs
NCBI-GeneID: 956108
NCBI-ProteinID: NP_758886
RS: NC_004455
UniProt: Q8Q7J5
LinkDB
Position
NC_004455:737..2290
AA seq 517 aa
MGASASGLRGEKLDELEKIRLRPSGKKKYQLKHIIWVSKELDRFGLHEKLLESKEGCEKI
LSVLFPLVPTGSENLISLYNTCCCVWCVHAKEKVTDTEEAKEKVKQKLHLVAEKENAASE
KEQRAIVTPSGRSKNYPIQIINQTPVHQGISPRTLNAWVKCIEEKKFSPEIVPMFIALSE
GCLPYDLNGMLNAIGDHQGALQIVKDVINEEAADWNLRHPQVGPMPQGVLRNPTGSDIAG
TTSSIEEQIEWTTREQDAVNVGGIYKQWIVLGLQKCVSMYNPVNILDIKQGPKEPFKDYV
DRFYKALRAERTDPQVKTWMTQTLLIQNANPDCKSILKGLGMNPSLEEMPLACQGVGGPK
YKAQMMAEAMKEAQSAVMMQNSGGPPRGPPRQPPRNIRCPNCGKFGHGLRDCISPRKKGC
FKCGDLGHIMRNCPKMVNFLGNTPWGSGKPRNFPAMPLTPTAPPMPGMEDPAERMLLDYM
KKGQQQKAESKQEKKERGPYEAAYNSLSSLFGTDQLQ
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgggcgcgagcgcgtcaggtcttaggggagaaaaattggacgagctggaaaagattagg
ttacggccctccggaaaaaagaaataccagctgaaacacataatatgggtaagcaaggaa
ctagacagatttggccttcatgaaaagctgttagaaagtaaggaaggatgcgagaaaatt
cttagcgtactctttccactagttcctacagggtcagaaaatttaatctcgctgtacaac
acctgctgctgcgtatggtgcgtacatgcgaaagagaaagtaacagatacagaggaagcg
aaagagaaagtaaaacaaaagctccatctagtggccgaaaaggaaaatgcagcatcagaa
aaagaacaaagagcaatagtgacacctagtggccgctcaaaaaattacccaatacagata
ataaatcagaccccagtccatcagggaatttcaccgcgcacgctgaatgcgtgggtaaaa
tgcatagaagagaagaagtttagcccagaaatagtgcccatgttcatagccttgtctgaa
gggtgcctcccctatgatctcaatggcatgctcaatgctattggagaccatcagggagcg
cttcaaatagtgaaggatgtcatcaatgaggaagctgcagactggaacttgagacaccca
caagtgggtcctatgccccaaggtgtcttgagaaacccaacgggcagtgatattgctgga
acaacaagctccatagaagagcagatagaatggactacaagggagcaagatgcagtaaat
gtgggaggaatatataaacaatggatagttttagggcttcagaagtgtgtaagcatgtat
aatccagtaaacatcctggacataaagcaaggaccaaaggagccgttcaaggactatgtg
gacaggttttacaaagctctgcgggcggagcggactgatccacaagtcaaaacctggatg
acacaaactttgctcatccagaatgctaacccagattgtaaatccatccttaaagggcta
ggcatgaatccctctttagaagagatgccgctagcctgccaaggggtaggaggccctaaa
tataaagcacaaatgatggcagaggctatgaaggaagcccagtcagctgtaatgatgcag
aattcgggagggccaccgcggggccccccgagacaacctcctagaaacatcagatgccct
aactgtggaaaatttggtcatgggctgagggactgtataagccctcgaaaaaagggatgc
ttcaagtgtggagatctaggacacataatgagaaattgcccaaagatggtgaatttttta
gggaataccccctggggcagtggcaaacccaggaacttcccggcgatgccattgacccca
acggcccctccaatgccagggatggaagacccagcagagagaatgctgttagattacatg
aagaaagggcaacagcagaaagcggaaagcaaacaggaaaagaaagagaggggtccatac
gaggcagcttacaactccctcagttctctctttggaacagaccaactacagtag

DBGET integrated database retrieval system