KEGG   Viruses: 956109
Entry
956109            CDS       T40000                                 

Gene name
nef, Siv2gp8
Definition
(RefSeq) Simian immunodeficiency virus SIV-mnd 2; nef protein
  KO
K22891  HIV-1 protein Nef
Taxonomy
TAX:159122
  Lineage
Viruses; ssRNA-RT viruses; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus; Puma lentivirus; Simian immunodeficiency virus - mnd
Organism
vg  Viruses (Simian immunodeficiency virus)
SSDB
Motif
Pfam: F-protein
Other DBs
NCBI-GeneID: 956109
NCBI-ProteinID: NP_758893
RS: NC_004455
UniProt: Q8AII3
LinkDB
Position
NC_004455:8722..9279
AA seq 185 aa
MGGKSSKQQEEKYLKYYKAMRRGYGAEGTNGDYQQLHASEPLLGALSTSQEEFDREQKSS
STDEEEETGFPVYPQCPVREPTYKDLVDMPHFLKEKGGLEGIWHSKRREEILDLYAQNEW
GFIPTWQSYTDGPGIRYPKTFRFLFKLCPVAVPPDQENNECNKLLQSSQLGIQEESLGRE
ASVEV
NT seq 558 nt   +upstreamnt  +downstreamnt
atgggtggcaagagctcaaaacagcaggaggaaaaatatttaaagtactacaaggctatg
cgcaggggctatggagcagagggcaccaatggggactatcaacagctgcatgcttcagag
ccattgctaggggcattatcaacatcccaagaagaattcgacagggagcagaagtcctcc
tcaactgacgaagaggaagaaacgggctttccagtatatccacagtgcccagtaagagaa
cccacctacaaggacttggttgatatgccccactttttaaaagaaaaggggggactggaa
gggatttggcattctaaaagaagagaagagatcttggacttatatgctcaaaatgaatgg
ggattcattcctacctggcaatcttatactgatggcccagggataagatacccgaagaca
tttaggttcttattcaagctttgcccggtggcagtgcctccagaccaggagaacaatgag
tgtaacaaattgctccagtcctctcagctgggaatccaggaagaatccttggggagagag
gctagtgtggaagtttga

DBGET integrated database retrieval system