KEGG   Viruses: 956113Help
Entry
956113            CDS       T40000                                 

Gene name
tat, Siv2gp6
Definition
(RefSeq) Simian immunodeficiency virus SIV-mnd 2; tat protein
  KO
K19258  HIV-1 protein Tat
Taxonomy
TAX:159122
  Lineage
Viruses; ssRNA-RT viruses; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus; Puma lentivirus; Simian immunodeficiency virus - mnd
Taxonomy
Organism
vg  Viruses (Simian immunodeficiency virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Tat Fer4_12
Motif
Other DBs
NCBI-GeneID: 956113
NCBI-ProteinID: NP_758891
RS: NC_004455
UniProt: Q8AII5
LinkDB All DBs
Position
NC_004455:join(6054..6270,8489..8625)
AA seq 117 aa AA seqDB search
MDAGKAVSDKKEGDVTPYDPFRDRTTPCDTCYCKRCCYHCQLCFLQKALGVHYHAYRNRR
SRQRLLEKISEDSRVIALFLMSSRETISVPTTSNSQAKKEKKSPTQKNRVPNQTAPK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagggaaagccgtatcggacaagaaggagggggatgttaccccttacgatcct
ttccgagatcggacaaccccctgtgacacatgttactgtaaaagatgttgctatcactgc
cagctatgcttcttgcagaaggccttaggagtacattatcatgcctacagaaacaggaga
tctagacagagacttctggaaaaaatatcagaagatagcagggttatcgccctcttcctt
atgtcttcaagggagactatctccgtccccacaacctcaaacagccaggcaaagaaagag
aagaagagcccgactcagaaaaacagagtaccaaatcagacagctccaaagtag

DBGET integrated database retrieval system