KEGG   Viruses: 956533Help
Entry
956533            CDS       T40000                                 

Gene name
NS1, FLUAVs8gp2
Definition
(RefSeq) Influenza A virus (A/Puerto Rico/8/1934(H1N1)); nonstructural protein 1
  KO
K19396  Influenza A virus non-structural protein 1
Taxonomy
TAX:211044 [GN:T40035]
  Lineage
Viruses; ssRNA viruses; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H1N1 subtype
Taxonomy
Organism
vg  Viruses (Influenza A virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Flu_NS1
Motif
Other DBs
NCBI-GeneID: 956533
NCBI-ProteinID: NP_040984
RS: NC_002020
UniProt: P03496
LinkDB All DBs
Structure
PDB: 

Position
NC_002020:27..719
AA seq 230 aa AA seqDB search
MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRA
GKQIVERILKEESDEALKMTMASVPASRYLTDMTLEEMSREWSMLIPKQKVAGPLCIRMD
QAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGV
LIGGLEWNDNTVRVSETLQRFAWRSSNENGRPPLTPKQKREMAGTIRSEV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggatccaaacactgtgtcaagctttcaggtagattgctttctttggcatgtccgcaaa
cgagttgcagaccaagaactaggtgatgccccattccttgatcggcttcgccgagatcag
aaatccctaagaggaaggggcagcactcttggtctggacatcgagacagccacacgtgct
ggaaagcagatagtggagcggattctgaaagaagaatccgatgaggcacttaaaatgacc
atggcctctgtacctgcgtcgcgttacctaaccgacatgactcttgaggaaatgtcaagg
gaatggtccatgctcatacccaagcagaaagtggcaggccctctttgtatcagaatggac
caggcgatcatggataaaaacatcatactgaaagcgaacttcagtgtgatttttgaccgg
ctggagactctaatattgctaagggctttcaccgaagagggagcaattgttggcgaaatt
tcaccattgccttctcttccaggacatactgctgaggatgtcaaaaatgcagttggagtc
ctcatcggaggacttgaatggaatgataacacagttcgagtctctgaaactctacagaga
ttcgcttggagaagcagtaatgagaatgggagacctccactcactccaaaacagaaacga
gaaatggcgggaacaattaggtcagaagtttga

DBGET integrated database retrieval system